Thermo Fisher Scientific Connexin 45 Polyclonal Antibody
Connexin 45 단백질을 표적하는 Rabbit Polyclonal Antibody로, Human, Mouse, Rat 시료에 반응합니다. Western blot 및 IHC(P) 실험에 적합하며, 항원 친화 크로마토그래피로 정제되었습니다. 연구용으로만 사용 가능합니다.
- 카탈로그번호
- PA579311
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific Connexin 45 Polyclonal Antibody
Applications
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human Connexin 45/GJA7 (91–131aa YLGYAIHKIAKMEHGEADKKAARSKPYAMRWKQHRALEETE) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage conditions | -20°C |
| Shipping conditions | Wet ice |
| RRID | AB_2746427 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Gap junctions are specialized structures on plasma membranes that enable direct cell-to-cell communication through transmembrane channels formed by connexins. Connexins differ among tissues and are categorized as alpha or beta types based on sequence similarities. CX43 is known as alpha-1 gap junction protein, while CX32 and CX26 are beta-1 and beta-2 types, respectively. Connexins have four transmembrane, three intracellular, and two extracellular regions, and their expression varies by tissue and developmental stage. Embryo implantation involves temporally regulated expression of connexins in both embryo and maternal decidua.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.