Thermo Fisher Scientific Connexin 45 Polyclonal Antibody
Connexin 45 단백질을 표적하는 Rabbit Polyclonal Antibody로, Human, Mouse, Rat 시료에 반응합니다. Western blot 및 IHC(P) 실험에 적합하며, 항원 친화 크로마토그래피로 정제되었습니다. 연구용으로만 사용 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human Connexin 45/GJA7 (91–131aa YLGYAIHKIAKMEHGEADKKAARSKPYAMRWKQHRALEETE) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage conditions | -20°C |
| Shipping conditions | Wet ice |
| RRID | AB_2746427 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Gap junctions are specialized structures on plasma membranes that enable direct cell-to-cell communication through transmembrane channels formed by connexins. Connexins differ among tissues and are categorized as alpha or beta types based on sequence similarities. CX43 is known as alpha-1 gap junction protein, while CX32 and CX26 are beta-1 and beta-2 types, respectively. Connexins have four transmembrane, three intracellular, and two extracellular regions, and their expression varies by tissue and developmental stage. Embryo implantation involves temporally regulated expression of connexins in both embryo and maternal decidua.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific GLI1 Polyclonal Antibody
Thermo Fisher Scientific
Thermo Fisher Scientific alpha Galactosidase Polyclonal Antibody
599,200원
Thermo Fisher Scientific
Thermo Fisher Scientific Connexin 45 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific GIP Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Growth Hormone Receptor Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|