CacheBy
Thermo Fisher Scientific alpha Galactosidase Polyclonal Antibody
원본

Thermo Fisher Scientific alpha Galactosidase Polyclonal Antibody

상품 한눈에 보기

Thermo Fisher Scientific의 알파 갈락토시다제 폴리클로날 항체로, 마우스 Gla C-말단 서열을 기반으로 제작되었습니다. Western blot에 적합하며, 동결건조 형태로 제공됩니다. 재구성 시 500 µg/mL 농도로 사용 가능하며, -20°C에서 보관합니다.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오전 04:03
Thermo Fisher Scientific PA579312 alpha Galactosidase Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
599,200원VAT 포함 659,120원

Thermo Fisher Scientific · Thermo Fisher Scientific alpha Galactosidase Polyclonal Antibody

Applications

Western Blot (WB)

  • Tested Dilution: 0.1–0.5 µg/mL

Product Specifications

항목 내용
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of mouse Gla (218–275aa: DIQYYCNHWRNFDDVYDSWESIKNILSWTVVYQKEIVEVA)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Storage Conditions -20°C
Shipping Conditions Wet ice
RRID AB_2746428

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.


Target Information

This gene encodes a homodimeric glycoprotein that hydrolyzes terminal alpha-galactosyl moieties from glycolipids and glycoproteins.
The enzyme primarily hydrolyzes ceramide trihexoside and catalyzes the hydrolysis of melibiose into galactose and glucose.
Mutations in this gene can disrupt enzyme synthesis, processing, and stability, leading to Fabry disease — a lysosomal storage disorder caused by defective catabolism of alpha-D-galactosyl glycolipid moieties.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.