Thermo Fisher Scientific alpha Galactosidase Polyclonal Antibody
Thermo Fisher Scientific의 알파 갈락토시다제 폴리클로날 항체로, 마우스 Gla C-말단 서열을 기반으로 제작되었습니다. Western blot에 적합하며, 동결건조 형태로 제공됩니다. 재구성 시 500 µg/mL 농도로 사용 가능하며, -20°C에서 보관합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of mouse Gla (218–275aa: DIQYYCNHWRNFDDVYDSWESIKNILSWTVVYQKEIVEVA) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746428 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
This gene encodes a homodimeric glycoprotein that hydrolyzes terminal alpha-galactosyl moieties from glycolipids and glycoproteins.
The enzyme primarily hydrolyzes ceramide trihexoside and catalyzes the hydrolysis of melibiose into galactose and glucose.
Mutations in this gene can disrupt enzyme synthesis, processing, and stability, leading to Fabry disease — a lysosomal storage disorder caused by defective catabolism of alpha-D-galactosyl glycolipid moieties.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific GLI2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific GLI1 Polyclonal Antibody
Thermo Fisher Scientific
Thermo Fisher Scientific alpha Galactosidase Polyclonal Antibody
599,200원
Thermo Fisher Scientific
Thermo Fisher Scientific Connexin 45 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific GIP Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|