Thermo Fisher Scientific alpha Galactosidase Polyclonal Antibody
Thermo Fisher Scientific의 알파 갈락토시다제 폴리클로날 항체로, 마우스 Gla C-말단 서열을 기반으로 제작되었습니다. Western blot에 적합하며, 동결건조 형태로 제공됩니다. 재구성 시 500 µg/mL 농도로 사용 가능하며, -20°C에서 보관합니다.
- 카탈로그번호
- PA579312
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific alpha Galactosidase Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of mouse Gla (218–275aa: DIQYYCNHWRNFDDVYDSWESIKNILSWTVVYQKEIVEVA) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746428 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
This gene encodes a homodimeric glycoprotein that hydrolyzes terminal alpha-galactosyl moieties from glycolipids and glycoproteins.
The enzyme primarily hydrolyzes ceramide trihexoside and catalyzes the hydrolysis of melibiose into galactose and glucose.
Mutations in this gene can disrupt enzyme synthesis, processing, and stability, leading to Fabry disease — a lysosomal storage disorder caused by defective catabolism of alpha-D-galactosyl glycolipid moieties.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.