
Atlas Antibodies Anti-TRIM11 Antibody
상품 한눈에 보기
인간 TRIM11 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 토끼에서 생산된 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 특이적으로 반응하며, 40% 글리세롤 및 PBS 완충액에 보존됩니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TRIM11 Antibody
Target Information
- Target Protein: Tripartite motif containing 11
- Target Gene: TRIM11
- Alternative Gene Names: BIA1, RNF92
Product Description
Polyclonal antibody against human TRIM11, produced in rabbit. Suitable for use in IHC, WB, and ICC applications.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
LGQQSAHLAELIAELEGRCQLPALGLLQDIKDALRRVQDVKLQPPEVVPMELRTVCRVPGLVETLRRFRGDVTLDP
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to orthologs:
- Mouse (ENSMUSG00000020455): 89%
- Rat (ENSRNOG00000002915): 88%
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
- Material Safety Data Sheet
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TRIM16 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TRIM13 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TRIM11 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TRIM10 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TRIB3 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.