AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TRIB3 Antibody
상품 한눈에 보기
Human TRIB3 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 높은 특이성과 재현성을 제공하며, Human에 반응성 검증 완료.
- 카탈로그번호
- HPA055442-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA055442-100 Anti-TRIB3 Antibody, tribbles pseudokinase 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055442-25 Anti-TRIB3 Antibody, tribbles pseudokinase 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TRIB3 Antibody
Anti-TRIB3 Antibody
Target Protein: tribbles pseudokinase 3
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human TRIB3.
Alternative Gene Names
C20orf97, dJ1103G7.3, TRB3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | tribbles pseudokinase 3 |
| Target Gene | TRIB3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | VKNNRMSANNDHFLTPTWQQMRATPLAAPAGSLSRKKRLELDDNLDTERPVQKRARSGPQPRLPPCLLPLSPPTAPDRATAV |
Verified Species Reactivity
- Human
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000032715 (44%)
- Rat ENSRNOG00000007319 (39%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.