CacheBy
Atlas Antibodies Anti-TRIM16 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TRIM16 Antibody

상품 한눈에 보기

인간 TRIM16 단백질을 인식하는 폴리클로날 항체로, IHC와 WB에 적합합니다. 토끼에서 생산된 IgG 타입 항체이며, PrEST 항원으로 친화 정제되었습니다. 인간에 대한 반응성이 검증되었으며, 보존용으로 글리세롤과 PBS 버퍼를 포함합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA023623-100 Anti-TRIM16 Antibody, tripartite motif containing 16 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023623-25 Anti-TRIM16 Antibody, tripartite motif containing 16 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TRIM16 Antibody

Anti-TRIM16 Antibody

Target Protein: tripartite motif containing 16 (TRIM16)

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human TRIM16.

Alternative Gene Names

  • EBBP

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein tripartite motif containing 16
Target Gene TRIM16
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000003219 (74%), Mouse ENSMUSG00000047821 (73%)

Antigen Sequence

CDFCLDDTRRVKAVKSCLTCMVNYCEEHLQPHQVNIKLQSHLLTEPVKDHNWRYCPAHHSPLSAFCCPDQQCICQDCCQEHSGHTIVSLDAARRDKEAELQCTQLDLERKLKLNENAISRLQANQKSVLVSVSEVKAVAEMQFGE

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.