
Atlas Antibodies Anti-TPCN2 Antibody
Human TPCN2 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC Orthogonal 검증을 통해 RNA-seq 데이터와 비교된 단백질 발현 확인. PrEST 항원으로 친화 정제된 고품질 항체로 다양한 연구 응용에 적합.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TPCN2 Antibody
Target: two pore segment channel 2 (TPCN2)
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against human TPCN2.
Alternative Gene Names
- TPC2
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
QFRGYLMKSLQTSLFRRRLGTRAAFEVLSSMVGEGGAFPQAVGVKPQNLLQVLQKVQLDSSHRQAMMEKVRSYGSVLLSAEEFQKLFNELDRSVVKEHPPRPEYQSPFLQSAQFLFGHYYF
Verified Species Reactivity
- Human
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000013387 | 63% |
| Mouse | ENSMUSG00000048677 | 63% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TPD52 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TPCN1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TPCN2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TP53RK Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TPBG Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|