원본

Atlas Antibodies Anti-TPCN2 Antibody

상품 한눈에 보기

Human TPCN2 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC Orthogonal 검증을 통해 RNA-seq 데이터와 비교된 단백질 발현 확인. PrEST 항원으로 친화 정제된 고품질 항체로 다양한 연구 응용에 적합.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA027080-100 Anti-TPCN2 Antibody, two pore segment channel 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA027080-25 Anti-TPCN2 Antibody, two pore segment channel 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-TPCN2 Antibody

Anti-TPCN2 Antibody

Target: two pore segment channel 2 (TPCN2)
Supplier: Atlas Antibodies

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against human TPCN2.

Alternative Gene Names

TPC2

Open Datasheet

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
QFRGYLMKSLQTSLFRRRLGTRAAFEVLSSMVGEGGAFPQAVGVKPQNLLQVLQKVQLDSSHRQAMMEKVRSYGSVLLSAEEFQKLFNELDRSVVKEHPPRPEYQSPFLQSAQFLFGHYYF

Verified Species Reactivity

Human

Interspecies Information

Species	Ortholog ID	Sequence Identity
Rat	ENSRNOG00000013387	63%
Mouse	ENSMUSG00000048677	63%

Antibody Characteristics

Property	Description
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand