CacheBy
Atlas Antibodies Anti-TP53RK Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TP53RK Antibody

상품 한눈에 보기

Human TP53 regulating kinase를 인식하는 rabbit polyclonal antibody. IHC 및 WB에 적합하며 PrEST 항원을 이용해 친화 정제됨. 높은 인간 특이성과 쥐·마우스 간 87% 서열 동일성 보유. 안정적 PBS/glycerol buffer에 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA015837-100 Anti-TP53RK Antibody, TP53 regulating kinase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA015837-25 Anti-TP53RK Antibody, TP53 regulating kinase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TP53RK Antibody

Anti-TP53RK Antibody

TP53 Regulating Kinase

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human TP53RK.

Alternative Gene Names

BUD32, C20orf64, dJ101A2.2, Nori-2p, prpk

Open Datasheet

Target Information

항목 내용
Target Protein TP53 regulating kinase
Target Gene TP53RK
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000007285 (87%), Mouse ENSMUSG00000042854 (87%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Antigen Sequence

AAVIKHRFPKGYRHPALEARLGRRRTVQEARALLRCRRAGISAPVVFFVDYASNCLYMEEIEGSVTVRDYIQSTMETEKTPQGLSNLAKTIGQV

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.