원본

Atlas Antibodies Anti-TPBG Antibody

상품 한눈에 보기

인체 TPBG 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. RNA-seq 데이터 기반 정교한 단백질 발현 검증을 거쳤으며, 고순도 친화 정제 방식으로 제조되었습니다. 인간에 대한 높은 특이성과 재현성을 제공합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA010554-100 Anti-TPBG Antibody, trophoblast glycoprotein 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA010554-25 Anti-TPBG Antibody, trophoblast glycoprotein 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Trophoblast Glycoprotein (TPBG)

IHC (Immunohistochemistry) – Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot)

Polyclonal antibody against human TPBG.

5T4, 5T4-AG

항목	내용
Target Protein	Trophoblast glycoprotein
Target Gene	TPBG
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence (Amino Acids)	LVSLTYVSFRNLTHLESLHLEDNALKVLHNGTLAELQGLPHIRVFLDNNPWVCDCHMADMVTWLKETEVVQGKDRLTCAYPEKMRNRVLLELNSADLDCDPILP
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000010694 (84%), Mouse ENSMUSG00000035274 (83%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.
Material Safety Data Sheet
Open Datasheet