
Atlas Antibodies Anti-TP53I3 Antibody
사람 TP53I3 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. 정제된 PrEST 항원을 사용하여 높은 특이성과 재현성 보장. 인간에 대한 검증 완료.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TP53I3 Antibody
Target: Tumor protein p53 inducible protein 3 (TP53I3)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation): 단백질 발현을 RNA-seq 데이터와 비교하여 고/저 발현 조직 간의 IHC 결과를 검증
- WB (Independent antibody validation): 서로 다른 에피토프를 인식하는 독립 항체와의 비교를 통해 단백질 발현 검증
- ICC: 세포 수준에서의 단백질 발현 분석에 적합
Product Description
Polyclonal antibody against human TP53I3 (tumor protein p53 inducible protein 3).
Alternative Gene Name: PIG3
Open Datasheet
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence:
MLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVAELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPE
Verified Species Reactivity
- Human
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000046844 | 35% |
| Rat | ENSRNOG00000011989 | 35% |
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol, PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet: MSDS - Sodium Azide
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 실험 조건에 맞는 최적 농도는 사용자가 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TP53BP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TP53I11 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TP53I3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TP53AIP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TP53BP1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|