CacheBy
Atlas Antibodies Anti-TP53BP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TP53BP1 Antibody

상품 한눈에 보기

인간 TP53BP1 단백질을 인식하는 폴리클로날 항체입니다. Western Blot과 Immunocytochemistry에 적합합니다. Rabbit 유래 IgG 형식으로 고순도 친화 정제되었습니다. 인간, Rat, Mouse 종에 모두 반응성이 확인되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA022133-100 Anti-TP53BP1 Antibody, tumor protein p53 binding protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA022133-25 Anti-TP53BP1 Antibody, tumor protein p53 binding protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TP53BP1 Antibody

Anti-TP53BP1 Antibody

Target: Tumor protein p53 binding protein 1 (TP53BP1)
Supplier: Atlas Antibodies


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human TP53BP1.


Alternative Gene Names

53BP1, p202

Open Datasheet


Target Information

  • Target Protein: Tumor protein p53 binding protein 1
  • Target Gene: TP53BP1
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
AYQCLLIADQHCRTRKYFLCLASGIPCVSHVWVHDSCHANQLQNYRNYLLPAGYSLEEQRILDWQPRENPFQNLKVLLVSDQQQNFLELWSEILMTGGAASVKQHHSSAHNKDIALGVFDVVVTDPSCPASVLKCAEAL

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000013837 (100%)
  • Mouse ENSMUSG00000043909 (100%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야별 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.