CacheBy
Atlas Antibodies Anti-TP53BP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TP53BP1 Antibody

상품 한눈에 보기

인체 TP53BP1 단백질을 표적으로 하는 폴리클로날 항체로, WB 및 ICC에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용해 친화정제되었습니다. Human에 대해 검증된 반응성을 가지며, 안정적 PBS/glycerol 버퍼에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA008788-100 Anti-TP53BP1 Antibody, tumor protein p53 binding protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA008788-25 Anti-TP53BP1 Antibody, tumor protein p53 binding protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TP53BP1 Antibody

Anti-TP53BP1 Antibody

Target: Tumor protein p53 binding protein 1 (TP53BP1)
Supplier: Atlas Antibodies


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human TP53BP1.


Alternative Gene Names

  • 53BP1
  • p202

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Tumor protein p53 binding protein 1
Target Gene TP53BP1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000013837 (100%), Mouse ENSMUSG00000043909 (100%)

Antigen Sequence

AYQCLLIADQHCRTRKYFLCLASGIPCVSHVWVHDSCHANQLQNYRNYLLPAGYSLEEQRILDWQPRENPFQNLKVLLVSDQQQNFLELWSEILMTGGAASVKQHHSSAHNKDIALGVFDVVVTDPSCPASVLKCAEAL


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.