
Atlas Antibodies Anti-TOR1AIP1 Antibody
상품 한눈에 보기
Human TOR1AIP1 단백질을 표적으로 하는 토르신 A 상호작용 단백질 1에 대한 폴리클로날 항체. IHC 및 WB에서 독립 항체 검증 완료. Rabbit 유래 IgG, PrEST 항원으로 친화 정제. 인간 반응성 검증 및 보존제가 포함된 PBS 버퍼 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TOR1AIP1 Antibody
Target Protein: torsin A interacting protein 1
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry): Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.
- WB (Western Blot): Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against human TOR1AIP1.
Alternative Gene Names
FLJ13142, LAP1B
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | torsin A interacting protein 1 |
| Target Gene | TOR1AIP1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000003946 (69%), Mouse ENSMUSG00000026466 (66%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
Antigen Sequence:
EEFRSDSAKEEVRESAYYLRSRQRRQPRPQETEEMKTRRTTRLQQQHSEQPPLQPSPVTTRRGLRDSHSSEEDEASSQTDLSQTISKKTVRS
Safety Information
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TOR1AIP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TOR1AIP2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TOR1AIP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TOR1A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TOP3B Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.