
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TOR1AIP1 Antibody
상품 한눈에 보기
Human TOR1AIP1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에서 독립적 항체 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. 다양한 연구용 단백질 발현 분석에 적합.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA070991-100 Anti-TOR1AIP1 Antibody, torsin 1A interacting protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA070991-25 Anti-TOR1AIP1 Antibody, torsin 1A interacting protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TOR1AIP1 Antibody
Anti-TOR1AIP1 Antibody
Target Protein: torsin A interacting protein 1
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry): Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.
- WB (Western Blot): Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against Human TOR1AIP1.
Alternative Gene Names
- FLJ13142
- LAP1B
Specifications
| 항목 | 내용 |
|---|---|
| Target Gene | TOR1AIP1 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | EEFRSDSAKEEVRESAYYLRSRQRRQPRPQETEEMKTRRTTRLQQQHSEQPPLQPSPVTTRRGLRDSHSSEEDEASSQTDLSQTISKKTVRS |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000003946 (69%), Mouse ENSMUSG00000026466 (66%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Material Safety Data Sheet (MSDS)
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



