CacheBy
Atlas Antibodies Anti-TOR1A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TOR1A Antibody

상품 한눈에 보기

Human TOR1A 단백질을 인식하는 토신 A 폴리클로날 항체로, 토신 패밀리 단백질 연구에 적합합니다. Rabbit IgG 형식이며, PrEST 항원 기반 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. ICC 등 다양한 응용에 사용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051195-100 Anti-TOR1A Antibody, torsin family 1, member A (torsin A) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051195-25 Anti-TOR1A Antibody, torsin family 1, member A (torsin A) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TOR1A Antibody

Anti-TOR1A Antibody

Target Information

  • Target Protein: torsin family 1, member A (torsin A)
  • Target Gene: TOR1A
  • Alternative Gene Names: DQ2, DYT1

이미지의 OCR 텍스트: ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human TOR1A

Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    QAVEPISLGLALAGVLTGYIYPRLYCLFAECCGQKRSLSREALQKDLDDNLFGQHLAKK

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000006894 (92%)
  • Mouse ENSMUSG00000026849 (88%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet
Material Safety Data Sheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.