
Atlas Antibodies Anti-TNFRSF13B Antibody
Human TNFRSF13B 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합. CD267(TACI) 대체명으로 알려진 TNFRSF13B를 표적하며, PrEST 항원으로 친화 정제됨. 40% glycerol/PBS buffer에 보존제로 sodium azide 포함.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TNFRSF13B Antibody
Target: Tumor necrosis factor receptor superfamily, member 13B
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against human TNFRSF13B (tumor necrosis factor receptor superfamily, member 13B).
Alternative Gene Names: CD267, TACI
Clonality: Polyclonal
Isotype: IgG
Host: Rabbit
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Tumor necrosis factor receptor superfamily, member 13B |
| Target Gene | TNFRSF13B |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000010142 (43%), Rat ENSRNOG00000002304 (40%) |
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
ACFLKKRGDPCSCQPRSRPRQSPAKSSQDHAMEAGSPVSTSPEPVETCSFCFPECRAPTQESAVTPGTPDPTCAGRWGCHTRTTVLQPCPHIPDSGLGIVCVPAQEBuffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Related Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TNFRSF12A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TNFRSF14 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TNFRSF13B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TNFRSF11A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TNFRSF11A Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|