CacheBy
Atlas Antibodies Anti-TNFRSF13B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2
Atlas Antibodies

Atlas Antibodies Anti-TNFRSF13B Antibody

상품 한눈에 보기

Human TNFRSF13B 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합. CD267(TACI) 대체명으로 알려진 TNFRSF13B를 표적하며, PrEST 항원으로 친화 정제됨. 40% glycerol/PBS buffer에 보존제로 sodium azide 포함.

브랜드
Atlas Antibodies
카테고리
Polyclonal Antibodies
판매단위
100ul, 25ul
#Antibodies#Atlas Antibodies

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030453-100 Anti-TNFRSF13B Antibody, tumor necrosis factor receptor superfamily, member 13B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030453-25 Anti-TNFRSF13B Antibody, tumor necrosis factor receptor superfamily, member 13B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-TNFRSF13B Antibody

Anti-TNFRSF13B Antibody

Target: Tumor necrosis factor receptor superfamily, member 13B
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human TNFRSF13B (tumor necrosis factor receptor superfamily, member 13B).

Alternative Gene Names: CD267, TACI
Clonality: Polyclonal
Isotype: IgG
Host: Rabbit

Target Information

항목 내용
Target Protein Tumor necrosis factor receptor superfamily, member 13B
Target Gene TNFRSF13B
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000010142 (43%), Rat ENSRNOG00000002304 (40%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

ACFLKKRGDPCSCQPRSRPRQSPAKSSQDHAMEAGSPVSTSPEPVETCSFCFPECRAPTQESAVTPGTPDPTCAGRWGCHTRTTVLQPCPHIPDSGLGIVCVPAQE

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Purification Method

Affinity purified using the PrEST antigen as affinity ligand.

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet (PDF)

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기
Atlas AntibodiesAtlas Antibodies Anti-TNFRSF12A Antibody528,000원VAT별도
Atlas AntibodiesAtlas Antibodies Anti-TNFRSF14 Antibody528,000원VAT별도
Atlas AntibodiesAtlas Antibodies Anti-TNFRSF11A Antibody528,000원VAT별도
Atlas AntibodiesAtlas Antibodies Anti-TNFRSF11A Antibody528,000원VAT별도

문의

0개
로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.