Atlas Antibodies Anti-TNFRSF11A Antibody

상품 한눈에 보기

Human TNFRSF11A 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. 다양한 종 간 교차 반응 정보 포함.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA027728-100 Anti-TNFRSF11A Antibody, tumor necrosis factor receptor superfamily, member 11a, NFKB activator 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA027728-25 Anti-TNFRSF11A Antibody, tumor necrosis factor receptor superfamily, member 11a, NFKB activator 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Tumor necrosis factor receptor superfamily, member 11a (NFKB activator)

Polyclonal antibody against human TNFRSF11A, also known as RANK. This antibody is affinity purified using the PrEST antigen as the affinity ligand.

CD265, FEO, LOH18CR1, PDB2, RANK

Target Protein: Tumor necrosis factor receptor superfamily, member 11a, NFKB activator
Target Gene: TNFRSF11A
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

KESSGDSCVSTHTANFGQQGACEGVLLLTLEEKTFPEDMCYPDQGGVCQGTCVGGGPYAQGEDARMLSLVSKTEIEEDSFRQMPTEDEYMDRPSQPTDQLLFLTEPGSKSTPPFSEPLE

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand