
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TNFRSF11A Antibody
상품 한눈에 보기
Human TNFRSF11A(RANK)을 표적으로 하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 및 WB에 적합하며, PrEST 항원으로 정제됨. Human에 반응하며, 안정적 PBS/glycerol buffer에 보존.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA047976-100 Anti-TNFRSF11A Antibody, tumor necrosis factor receptor superfamily, member 11a, NFKB activator 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047976-25 Anti-TNFRSF11A Antibody, tumor necrosis factor receptor superfamily, member 11a, NFKB activator 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TNFRSF11A Antibody
Anti-TNFRSF11A Antibody
Target: Tumor necrosis factor receptor superfamily, member 11a (NFKB activator)
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against human TNFRSF11A.
Alternative Gene Names
CD265, FEO, LOH18CR1, PDB2, RANK
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Tumor necrosis factor receptor superfamily, member 11a, NFKB activator |
| Target Gene | TNFRSF11A |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000015615 (56%), Mouse ENSMUSG00000026321 (54%) |
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
KESSGDSCVSTHTANFGQQGACEGVLLLTLEEKTFPEDMCYPDQGGVCQGTCVGGGPYAQGEDARMLSLVSKTEIEEDSFRQMPTEDEYMDRPSQPTDQLLFLTEPGSKSTPPFSEPLE
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



