
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GCN1 Antibody
상품 한눈에 보기
Human GCN1 단백질을 인식하는 rabbit polyclonal 항체로, IHC 및 ICC 등 다양한 응용에 적합합니다. PrEST 항원으로 친화 정제되었으며, 높은 종간 보존성과 신뢰성 있는 검증 데이터를 제공합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA018799-100 Anti-GCN1 Antibody, GCN1 eIF2 alpha kinase activator homolog 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018799-25 Anti-GCN1 Antibody, GCN1 eIF2 alpha kinase activator homolog 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GCN1 Antibody
Anti-GCN1 Antibody
GCN1 eIF2 alpha kinase activator homolog
Recommended Applications
- IHC (Independent antibody validation)
- ICC
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human GCN1
Alternative Gene Names
GCN1L, GCN1L1, KIAA0219
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | GCN1 eIF2 alpha kinase activator homolog |
| Target Gene | GCN1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | EALVTDAGEVTEAGKAYVPPRVLQEALCVISGVPGLKGDVTDTEQLAQEMLIISHHPSLVAVQSGLWPALLARMKIDPEAFITRHLDQIIPRMTTQSPLNQSSMNAMGSLSVLSPDRVLPQLISTITA |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000041638 (94%), Rat ENSRNOG00000021871 (92%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



