CacheBy
Atlas Antibodies Anti-GCN1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GCN1 Antibody

상품 한눈에 보기

인간 GCN1 단백질을 표적으로 하는 토끼 폴리클로날 항체. IHC 및 ICC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 인간에 대해 검증되었으며, 마우스 및 랫과 높은 서열 유사성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA019648-100 Anti-GCN1 Antibody, GCN1 eIF2 alpha kinase activator homolog 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019648-25 Anti-GCN1 Antibody, GCN1 eIF2 alpha kinase activator homolog 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GCN1 Antibody

Anti-GCN1 Antibody

Target: GCN1 eIF2 alpha kinase activator homolog
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry) – Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human GCN1.


Alternative Gene Names

GCN1L, GCN1L1, KIAA0219

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein GCN1 eIF2 alpha kinase activator homolog
Target Gene GCN1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000041638 (94%), Rat ENSRNOG00000021871 (92%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

Antigen Sequence

EALVTDAGEVTEAGKAYVPPRVLQEALCVISGVPGLKGDVTDTEQLAQEMLIISHHPSLVAVQSGLWPALLARMKIDPEAFITRHLDQIIPRMTTQSPLNQSSMNAMGSLSVLSPDRVLPQLISTITA

제품 이미지

Enhanced Validation
IHC Independent Validation
Independent Validation Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.