Atlas Antibodies Anti-GCLM Antibody

상품 한눈에 보기

Human GCLM 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합함. Rabbit 호스트에서 생산되며, 정제된 IgG 형태로 제공. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증된 신뢰성 높은 제품.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA023696-100 Anti-GCLM Antibody, glutamate-cysteine ligase, modifier subunit 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA023696-25 Anti-GCLM Antibody, glutamate-cysteine ligase, modifier subunit 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-GCLM Antibody

Anti-GCLM Antibody

Target Protein: glutamate-cysteine ligase, modifier subunit (GCLM)

Recommended Applications

IHC (Immunohistochemistry)
WB (Western Blot) – Orthogonal validation
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human GCLM

Alternative Gene Names

GLCLR

Open Datasheet

Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
RTLHLQTGNLLNWGRLRKKCPSTHSEELHDCIQKTLNEWSSQINPDLVREFPDVLECTVSHAVE

Verified Species Reactivity

Human

Interspecies Information

Species	Gene ID	Sequence Identity
Mouse	ENSMUSG00000028124	94%
Rat	ENSRNOG00000013409	94%

Antibody Properties

Property	Description
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand