
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GCC1 Antibody
상품 한눈에 보기
Human GCC1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 독립 항체 비교 및 siRNA knockdown을 통한 검증 완료. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA019369-100 Anti-GCC1 Antibody, GRIP and coiled-coil domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019369-25 Anti-GCC1 Antibody, GRIP and coiled-coil domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GCC1 Antibody
Anti-GCC1 Antibody
Target: GRIP and coiled-coil domain containing 1 (GCC1)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Independent antibody validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
- WB (Genetic validation): Genetic validation in WB by siRNA knockdown.
- ICC: Suitable for immunocytochemistry applications.
Product Description
Polyclonal antibody against human GCC1.
Alternative Gene Names
FLJ22035, GCC1P, GCC88, MGC20706
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | GRIP and coiled-coil domain containing 1 |
| Target Gene | GCC1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | LELRLEETREALAGRAYAAEQMEGFELQTKQLTREVEELKSELQAIRDEKNQPDPRLQELQEEAARLKSHFQAQLQQEMR |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000007792 (93%), Mouse ENSMUSG00000029708 (93%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



