CacheBy
Atlas Antibodies Anti-GCC1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GCC1 Antibody

상품 한눈에 보기

Human GCC1 단백질을 타깃으로 하는 Rabbit Polyclonal 항체. IHC, WB, ICC 등 다양한 응용에 적합하며 독립 항체 및 유전적 검증으로 신뢰성 확보. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이도 제공.

카탈로그번호
HPA021323-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA021323-100 Anti-GCC1 Antibody, GRIP and coiled-coil domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021323-25 Anti-GCC1 Antibody, GRIP and coiled-coil domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GCC1 Antibody

Anti-GCC1 Antibody

GRIP and coiled-coil domain containing 1

  • IHC (Independent Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Genetic Validation): Genetic validation in WB by siRNA knockdown.
  • ICC: Suitable for immunocytochemistry applications.

Product Description

Polyclonal Antibody against Human GCC1

Alternative Gene Names

FLJ22035, GCC1P, GCC88, MGC20706

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein GRIP and coiled-coil domain containing 1
Target Gene GCC1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence LELRLEETREALAGRAYAAEQMEGFELQTKQLTREVEELKSELQAIRDEKNQPDPRLQELQEEAARLKSHFQAQLQQEMR
Verified Species Reactivity Human
Interspecies Homology Rat ENSRNOG00000007792 (93%), Mouse ENSMUSG00000029708 (93%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
WB Genetic Validation
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.