Atlas Antibodies Anti-GCA Antibody

상품 한눈에 보기

인간 GCA(grancalcin) 단백질을 인식하는 폴리클로날 항체로 IHC, WB, ICC 등 다양한 응용에 적합. Orthogonal 및 Independent validation을 통해 높은 신뢰성 확보. Rabbit IgG 기반으로 PrEST 항원 정제. PBS/glycerol buffer에 보존.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA035034-100 Anti-GCA Antibody, grancalcin, EF-hand calcium binding protein 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA035034-25 Anti-GCA Antibody, grancalcin, EF-hand calcium binding protein 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-GCA Antibody

Anti-GCA Antibody

Target: grancalcin, EF-hand calcium binding protein
Type: Polyclonal Antibody against Human GCA

Recommended Applications

IHC (Orthogonal validation): 단백질 발현을 RNA-seq 데이터와 비교하여 고·저 발현 조직 간의 IHC 결과를 검증
WB (Independent validation): 서로 다른 에피토프를 인식하는 독립 항체 간의 단백질 발현 비교로 검증
ICC: 세포 내 단백질 발현 분석에 사용

Product Description

Polyclonal antibody targeting human GCA (grancalcin, EF-hand calcium binding protein).

Alternative Gene Names: GCL
Target Gene: GCA
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

MAYPGYGGGFGNFSIQVPGMQMGQPVPETGPAILLDGYSGPAYSDTYSSAGDSVYTYFSAV

Verified Species Reactivity

Human

Interspecies Identity:

Mouse (ENSMUSG00000026893): 64%
Rat (ENSRNOG00000007359): 64%

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol, PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using PrEST antigen as affinity ligand
Storage	Store at recommended temperature; mix gently before use
Notes	Optimal concentrations and conditions should be determined by the user