
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GAS2 Antibody
상품 한눈에 보기
인간 GAS2 단백질을 인식하는 토끼 유래 폴리클로날 항체. IHC 및 ICC 응용에 적합하며 RNA-seq 데이터 기반 정교한 orthogonal 검증 수행. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA058904-100 Anti-GAS2 Antibody, growth arrest-specific 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058904-25 Anti-GAS2 Antibody, growth arrest-specific 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GAS2 Antibody
Anti-GAS2 Antibody
Target: growth arrest-specific 2 (GAS2)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry) – Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human GAS2
Open Datasheet (PDF)
Antigen Information
- Target Protein: growth arrest-specific 2
- Target Gene: GAS2
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
FAGYLLKHDPCRMLQISRVDGKTSPIQSKSPTLKDMNPDNYLVVSASYKAKKEI
Verified Species Reactivity
Human
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Identity |
|----------|----------|-----------|
| Mouse | ENSMUSG00000030498 | 96% |
| Rat | ENSRNOG00000016717 | 96% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



