Atlas Antibodies Anti-GAS2 Antibody

상품 한눈에 보기

인간 GAS2 단백질을 인식하는 토끼 유래 폴리클로날 항체. IHC 및 ICC 응용에 적합하며 RNA-seq 데이터 기반 정교한 orthogonal 검증 수행. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA058904-100 Anti-GAS2 Antibody, growth arrest-specific 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA058904-25 Anti-GAS2 Antibody, growth arrest-specific 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-GAS2 Antibody

Anti-GAS2 Antibody

Target: growth arrest-specific 2 (GAS2)
Supplier: Atlas Antibodies

Recommended Applications

IHC (Immunohistochemistry) – Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human GAS2
Open Datasheet (PDF)

Antigen Information

Target Protein: growth arrest-specific 2
Target Gene: GAS2
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
```
FAGYLLKHDPCRMLQISRVDGKTSPIQSKSPTLKDMNPDNYLVVSASYKAKKEI
```

Verified Species Reactivity

Human

Interspecies Information:
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Identity |
|----------|----------|-----------|
| Mouse | ENSMUSG00000030498 | 96% |
| Rat | ENSRNOG00000016717 | 96% |

Antibody Characteristics

Property	Description
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand