
Atlas Antibodies Anti-GAS2 Antibody
인간 GAS2 단백질을 인식하는 토끼 유래 폴리클로날 항체. IHC 및 ICC 응용에 적합하며 RNA-seq 데이터 기반 정교한 orthogonal 검증 수행. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GAS2 Antibody
Target: growth arrest-specific 2 (GAS2)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry) – Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human GAS2
Open Datasheet (PDF)
Antigen Information
- Target Protein: growth arrest-specific 2
- Target Gene: GAS2
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
FAGYLLKHDPCRMLQISRVDGKTSPIQSKSPTLKDMNPDNYLVVSASYKAKKEI
Verified Species Reactivity
Human
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Identity |
|----------|----------|-----------|
| Mouse | ENSMUSG00000030498 | 96% |
| Rat | ENSRNOG00000016717 | 96% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-GAS2L3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GAS1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GAS2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GAREM1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GAREM2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|