CacheBy
Atlas Antibodies Anti-GAS1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GAS1 Antibody

상품 한눈에 보기

Human GAS1 단백질을 인식하는 폴리클로날 항체로, Rabbit 유래 IgG 형식입니다. Affinity purification 방식으로 정제되었으며, ICC 등 다양한 응용에 적합합니다. 고순도와 높은 특이성을 제공하여 신뢰성 있는 연구 결과를 지원합니다.

카탈로그번호
HPA036085-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036085-100 Anti-GAS1 Antibody, growth arrest-specific 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036085-25 Anti-GAS1 Antibody, growth arrest-specific 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GAS1 Antibody

Anti-GAS1 Antibody

Target Information

  • Target Protein: growth arrest-specific 1
  • Target Gene: GAS1
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
TVIEDMLAMPKAALLNDCVCDGLERPICESVKENMARLCFGAELGNGPGSSGSDGGLDDYYDEDYDDEQRTGGAGGEQPLDDDDG

Product Description

Polyclonal antibody against Human GAS1.

Open Datasheet (PDF)

  • ICC (Immunocytochemistry)

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000050485 (89%)
  • Mouse ENSMUSG00000052957 (89%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.