
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GAREM2 Antibody
상품 한눈에 보기
인간 GAREM2 단백질을 인식하는 토끼 폴리클로날 항체. MAPK1 신호 조절 관련 단백질 연구용. 인간에서 검증되었으며, 쥐·생쥐와 높은 서열 유사성 보유. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 신뢰성 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA071575-100 Anti-GAREM2 Antibody, GRB2 associated regulator of MAPK1 subtype 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA071575-25 Anti-GAREM2 Antibody, GRB2 associated regulator of MAPK1 subtype 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GAREM2 Antibody
Anti-GAREM2 Antibody
GRB2 associated regulator of MAPK1 subtype 2
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human GAREM2.
Alternative Gene Names
FAM59B, FLJ00375, GAREML, KIAA2038
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | GRB2 associated regulator of MAPK1 subtype 2 |
| Target Gene | GAREM2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | REGHCYKLVSIISKTVVLGLALRREGPAPLHFLLLTDTPRFALPQGLLAGDPRVERLVRDSASYCRERFDPDEY |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | Ortholog ID | 서열 유사성 |
|---|---|---|
| Rat | ENSRNOG00000048004 | 99% |
| Mouse | ENSMUSG00000044576 | 99% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol, PBS (pH 7.2), 0.02% sodium azide (preservative) |
| MSDS | Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



