CacheBy
Thermo Fisher Scientific CHRNA3 Polyclonal Antibody
원본

Thermo Fisher Scientific CHRNA3 Polyclonal Antibody

상품 한눈에 보기

CHRNA3 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody. Western blot 및 flow cytometry에 적합. 인간, 마우스, 랫트 반응성. 항원 친화 크로마토그래피로 정제된 동결건조 형태. 연구용으로만 사용 가능.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 07. 28. 오후 02:06
Thermo Fisher Scientific PA579045 CHRNA3 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific CHRNA3 Polyclonal Antibody

Thermo Fisher Scientific CHRNA3 Polyclonal Antibody

Applications and Tested Dilution

Application Tested Dilution
Western Blot (WB) 0.1–0.5 µg/mL
Flow Cytometry (Flow) 1–3 µg/1×10⁶ cells

Product Specifications

항목 내용
Species Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence of human CHRNA3 (DAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQD)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS with 4 mg trehalose
Contains 0.05 mg sodium azide
Storage Conditions -20°C
Shipping Conditions Wet ice
RRID AB_2746161

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

CHRNA3 locus encodes a member of the nicotinic acetylcholine receptor family of proteins. Members of this family form pentameric complexes comprised of both alpha and beta subunits. This locus encodes an alpha-type subunit containing adjacent cysteine residues characteristic of this group. The encoded protein is a ligand-gated ion channel involved in neurotransmission. Polymorphisms in this gene are associated with increased risk of smoking initiation and susceptibility to lung cancer. Alternatively spliced transcript variants have been described.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

제품 이미지

(이미지 없음)

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.