Thermo Fisher Scientific Granzyme B Polyclonal Antibody
Granzyme B 단백질을 인식하는 Rabbit Polyclonal Antibody로, Human, Mouse, Rat 시료에 반응합니다. WB, IHC, ICC/IF, ELISA에 사용 가능하며, 고순도 Affinity Chromatography 정제 및 안정한 PBS/glycerol buffer로 제공됩니다. 연구용으로 세포 사멸 관련 기작 분석에 적합합니다.
- 카탈로그번호
- PA596161
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific Granzyme B Polyclonal Antibody
Applications
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:500–1:1,000 |
| Immunohistochemistry (Paraffin) (IHC (P)) | 1:50–1:200 |
| Immunocytochemistry (ICC/IF) | 1:50–1:200 |
| ELISA | 1 µg/mL |
Product Specifications
| Item | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to amino acids 100–200 of human Granzyme B (NP_0041222) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 1.41 mg/mL |
| Purification | Affinity Chromatography |
| Storage Buffer | PBS (pH 7.3) with 50% glycerol |
| Contains | 0.09% sodium azide |
| Storage Conditions | −20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2807963 |
Product Specific Information
- Immunogen sequence: YNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFK
- Positive Samples: Mouse spleen, Mouse lung, Mouse thymus
- Cellular Location: Cytoplasmic granule
Target Information
Granzyme B is a member of the granzyme serine protease family found in cytotoxic T cells and NK cell granules. It plays a key role in apoptosis induction by cleaving caspase-3 and initiating the caspase cascade. Granzyme B also triggers mitochondrial apoptosis via Bid protein cleavage. It is stored in specialized lytic granules of CTLs and NK cells and functions through the mannose 6-phosphate receptor as a death receptor during cytotoxic T cell-induced apoptosis.
For Research Use Only. Not for use in diagnostic procedures or resale without authorization.
제품 이미지
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.