Thermo Fisher Scientific Granzyme B Polyclonal Antibody
Granzyme B 단백질을 인식하는 Rabbit Polyclonal Antibody로, Human, Mouse, Rat 시료에 반응합니다. WB, IHC, ICC/IF, ELISA에 사용 가능하며, 고순도 Affinity Chromatography 정제 및 안정한 PBS/glycerol buffer로 제공됩니다. 연구용으로 세포 사멸 관련 기작 분석에 적합합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:500–1:1,000 |
| Immunohistochemistry (Paraffin) (IHC (P)) | 1:50–1:200 |
| Immunocytochemistry (ICC/IF) | 1:50–1:200 |
| ELISA | 1 µg/mL |
Product Specifications
| Item | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to amino acids 100–200 of human Granzyme B (NP_0041222) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 1.41 mg/mL |
| Purification | Affinity Chromatography |
| Storage Buffer | PBS (pH 7.3) with 50% glycerol |
| Contains | 0.09% sodium azide |
| Storage Conditions | −20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2807963 |
Product Specific Information
- Immunogen sequence: YNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFK
- Positive Samples: Mouse spleen, Mouse lung, Mouse thymus
- Cellular Location: Cytoplasmic granule
Target Information
Granzyme B is a member of the granzyme serine protease family found in cytotoxic T cells and NK cell granules. It plays a key role in apoptosis induction by cleaving caspase-3 and initiating the caspase cascade. Granzyme B also triggers mitochondrial apoptosis via Bid protein cleavage. It is stored in specialized lytic granules of CTLs and NK cells and functions through the mannose 6-phosphate receptor as a death receptor during cytotoxic T cell-induced apoptosis.
For Research Use Only. Not for use in diagnostic procedures or resale without authorization.
제품 이미지
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific CD155 Polyclonal Antibody
735,100원
Thermo Fisher Scientific
Thermo Fisher Scientific TFEB Polyclonal Antibody
627,600원
Thermo Fisher Scientific
Thermo Fisher Scientific Granzyme B Polyclonal Antibody
747,800원
Thermo Fisher Scientific
Thermo Fisher Scientific CD204 Polyclonal Antibody
690,200원
Thermo Fisher Scientific
Thermo Fisher Scientific CD319 (CRACC) Polyclonal Antibody
655,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|