
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TMBIM4 Antibody
상품 한눈에 보기
Human TMBIM4 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity 정제 방식으로 제조되었습니다. 다양한 응용 분야에 적합하며, 40% 글리세롤 기반 PBS 버퍼로 안정화되어 있습니다. Human에 대해 검증되었습니다.
- 카탈로그번호
- HPA077642-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA077642-100 Anti-TMBIM4 Antibody, transmembrane BAX inhibitor motif containing 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA077642-25 Anti-TMBIM4 Antibody, transmembrane BAX inhibitor motif containing 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TMBIM4 Antibody
Anti-TMBIM4 Antibody
Target: transmembrane BAX inhibitor motif containing 4 (TMBIM4)
Type: Polyclonal Antibody against Human TMBIM4
Recommended Applications
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody raised in rabbit against Human TMBIM4.
This antibody recognizes the transmembrane BAX inhibitor motif containing 4 protein.
Alternative Gene Names
CGI-119, GAAP, LFG4, S1R, ZPRO
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | transmembrane BAX inhibitor motif containing 4 |
| Target Gene | TMBIM4 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | RYPRSSIEDDFNYGSSVASATVHIRMVLQRDCTFSKQYMRIPSAPSATLNIIRFFHLRQSGRSGMVNIFYKGPTFL |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000004312 (33%), Mouse ENSMUSG00000020225 (32%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



