
Atlas Antibodies Anti-TMBIM4 Antibody
상품 한눈에 보기
Human TMBIM4 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity 정제 방식으로 제조되었습니다. 다양한 응용 분야에 적합하며, 40% 글리세롤 기반 PBS 버퍼로 안정화되어 있습니다. Human에 대해 검증되었습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TMBIM4 Antibody
Target: transmembrane BAX inhibitor motif containing 4 (TMBIM4)
Type: Polyclonal Antibody against Human TMBIM4
Recommended Applications
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody raised in rabbit against Human TMBIM4.
This antibody recognizes the transmembrane BAX inhibitor motif containing 4 protein.
Alternative Gene Names
CGI-119, GAAP, LFG4, S1R, ZPRO
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | transmembrane BAX inhibitor motif containing 4 |
| Target Gene | TMBIM4 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | RYPRSSIEDDFNYGSSVASATVHIRMVLQRDCTFSKQYMRIPSAPSATLNIIRFFHLRQSGRSGMVNIFYKGPTFL |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000004312 (33%), Mouse ENSMUSG00000020225 (32%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
