CacheBy
Atlas Antibodies Anti-TMC3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TMC3 Antibody

상품 한눈에 보기

Human TMC3 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 타입입니다. Affinity purification 방식으로 정제되었으며, ICC 등 다양한 응용에 적합합니다. PBS/glycerol buffer에 보존되어 안정적인 사용이 가능합니다.

카탈로그번호
HPA040265-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040265-100 Anti-TMC3 Antibody, transmembrane channel-like 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040265-25 Anti-TMC3 Antibody, transmembrane channel-like 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TMC3 Antibody

Anti-TMC3 Antibody

Target Information

  • Target Protein: transmembrane channel-like 3
  • Target Gene: TMC3
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
TPMTFTTHIEDVHSEPLFRKDFQQINPPHRGPQASTLLAQGPRPHAPRYYVINEYDSYKKKHLNVWPERHFKIDASGDIVELYPRNV

Product Description

Polyclonal Antibody against Human TMC3

Open Datasheet

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000038540 (63%)
  • Rat ENSRNOG00000025088 (60%)

Immunocytochemistry (ICC)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.