CacheBy
Atlas Antibodies Anti-TMC2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TMC2 Antibody

상품 한눈에 보기

Human TMC2 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. Affinity purification 방식으로 정제되어 높은 특이성과 재현성을 제공. IHC 등 다양한 연구 응용에 적합. Human 반응성이 검증됨.

카탈로그번호
HPA046350-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046350-100 Anti-TMC2 Antibody, transmembrane channel-like 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046350-25 Anti-TMC2 Antibody, transmembrane channel-like 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TMC2 Antibody

Anti-TMC2 Antibody

Target Information

  • Target Protein: Transmembrane channel-like 2
  • Target Gene: TMC2
  • Alternative Gene Names: C20orf145, dJ686C3.3

면역조직화학(IHC) 등 다양한 연구용 응용에 적합합니다.

Product Description

Polyclonal Antibody against Human TMC2

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

QVLREVEKSHKSVKGKATARDSEDTPKSSSKNATQLQLTKEETTPPSASQSQAMDKKAQGPGTSNSASRT

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000060332 64%
Rat ENSRNOG00000007017 61%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 맞는 최적 조건은 사용자가 직접 결정해야 합니다.

Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.