Thermo Fisher Scientific MDMX Polyclonal Antibody
MDMX 단백질을 표적하는 Thermo Fisher Scientific의 폴리클로날 항체로, Western blot과 IHC(Paraffin)에 적합합니다. Rabbit IgG 기반으로 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공됩니다. 인간 및 생쥐 시료에 반응합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human MDMX (35–72aa KILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQH) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746768 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The MDM2 protein is the primary regulator of p53 protein stability. MDMX is an MDM2-related protein that inhibits MDM2-mediated degradation of p53 via distinct associations with MDM2. The gene that encodes MDMX (also designated MDM4) is a target for amplification in malignant gliomas.
ARF interacts with MDMX to sequester MDMX within the nucleolus. This sequestration of MDMX by ARF results in an increase in p53 transactivation.
In addition, expression of MDMX can reverse MDM2-targeted degradation of p53 while maintaining suppression of p53 transactivation.
Like MDM2, MDMX also binds p73 and stabilizes the level of p73. Therefore, in striking contrast to p53, the half-life of p73 is increased by binding to MDM2.
For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific MED13 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific MDC1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific MDMX Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific MCM7 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific MCM7 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|