Thermo Fisher Scientific FABP5 Polyclonal Antibody
FABP5 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal 항체로, WB, IHC, ICC/IF에 사용 가능. 고순도 항원 친화 크로마토그래피 정제, Lyophilized 형태로 제공되며 재구성 후 500 µg/mL 농도. 인간, 생쥐, 랫드 반응성.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific FABP5 Polyclonal Antibody
Applications
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 5 µg/mL |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of mouse FABP5 (KWRLMESHGFEEYMKELGVGLALRKMAAMAKPD) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746348 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
FABP5 (fatty acid binding protein 5, psoriasis-associated) is encoded by the FABP5 gene and belongs to a family of small, highly conserved cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands.
The PAFABP cDNA encodes a 135-amino acid protein with a molecular weight of approximately 15,164 Da. This gene is expressed in epidermal cells and was first identified as upregulated in psoriasis tissue.
FABPs are involved in fatty acid uptake, transport, and metabolism. Studies (Kaczocha et al., 2009) have shown that FABP5 and FABP7 act as cytosolic carriers transporting AEA to subcellular fatty acid amide hydrolase for hydrolysis and inactivation, whereas FABP3 does not exhibit this specific transport function.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.