Thermo Fisher Scientific FABP5 Polyclonal Antibody
FABP5 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal 항체로, WB, IHC, ICC/IF에 사용 가능. 고순도 항원 친화 크로마토그래피 정제, Lyophilized 형태로 제공되며 재구성 후 500 µg/mL 농도. 인간, 생쥐, 랫드 반응성.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 5 µg/mL |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of mouse FABP5 (KWRLMESHGFEEYMKELGVGLALRKMAAMAKPD) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746348 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
FABP5 (fatty acid binding protein 5, psoriasis-associated) is encoded by the FABP5 gene and belongs to a family of small, highly conserved cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands.
The PAFABP cDNA encodes a 135-amino acid protein with a molecular weight of approximately 15,164 Da. This gene is expressed in epidermal cells and was first identified as upregulated in psoriasis tissue.
FABPs are involved in fatty acid uptake, transport, and metabolism. Studies (Kaczocha et al., 2009) have shown that FABP5 and FABP7 act as cytosolic carriers transporting AEA to subcellular fatty acid amide hydrolase for hydrolysis and inactivation, whereas FABP3 does not exhibit this specific transport function.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific FAS (CD95) Polyclonal Antibody
Thermo Fisher Scientific
Thermo Fisher Scientific FABP5 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific FABP5 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific FABP2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific FABP4 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|