
원본
Thermo Fisher Scientific FABP4 Polyclonal Antibody
상품 한눈에 보기
FABP4 단백질을 인식하는 Thermo Fisher Scientific의 폴리클로날 항체로, Western blot 및 IHC(P)에서 검증됨. Human, Mouse, Rat 반응성. 항원 친화 크로마토그래피로 정제된 동결건조 형태. 연구용으로만 사용 가능.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 03. 오전 12:41
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA579231 FABP4 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific FABP4 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human FABP4 (10–40aa KLVSSENFDDYMKEVGVGFATRKVAGMAKPN) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | –20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746347 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
FABP4는 fatty acid binding protein (FABP) 패밀리에 속하며, 지방산과 기타 지질의 세포 내 운반에 관여합니다. FABP4는 지방세포(adipocytes), 대식세포(macrophages), 단핵세포 유래 수지상세포(monocyte-derived dendritic cells), 근상피세포(myoepithelial cells)에서 발현됩니다. 이 단백질은 긴 사슬 지방산과 레티노산(retinoic acid)을 핵 내 수용체로 전달합니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
