원본
Thermo Fisher Scientific FABP4 Polyclonal Antibody
상품 한눈에 보기
FABP4 단백질을 인식하는 Thermo Fisher Scientific의 폴리클로날 항체로, Western blot 및 IHC(P)에서 검증됨. Human, Mouse, Rat 반응성. 항원 친화 크로마토그래피로 정제된 동결건조 형태. 연구용으로만 사용 가능.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 03. 오전 12:41
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA579231 FABP4 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific FABP4 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human FABP4 (10–40aa KLVSSENFDDYMKEVGVGFATRKVAGMAKPN) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | –20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746347 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
FABP4는 fatty acid binding protein (FABP) 패밀리에 속하며, 지방산과 기타 지질의 세포 내 운반에 관여합니다. FABP4는 지방세포(adipocytes), 대식세포(macrophages), 단핵세포 유래 수지상세포(monocyte-derived dendritic cells), 근상피세포(myoepithelial cells)에서 발현됩니다. 이 단백질은 긴 사슬 지방산과 레티노산(retinoic acid)을 핵 내 수용체로 전달합니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific FABP5 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific FABP2 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific FABP2 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific Factor VIII Polyclonal Antibody568,000원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.