Thermo Fisher Scientific FABP4 Polyclonal Antibody
FABP4 단백질을 인식하는 Thermo Fisher Scientific의 폴리클로날 항체로, Western blot 및 IHC(P)에서 검증됨. Human, Mouse, Rat 반응성. 항원 친화 크로마토그래피로 정제된 동결건조 형태. 연구용으로만 사용 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human FABP4 (10–40aa KLVSSENFDDYMKEVGVGFATRKVAGMAKPN) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | –20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746347 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
FABP4는 fatty acid binding protein (FABP) 패밀리에 속하며, 지방산과 기타 지질의 세포 내 운반에 관여합니다. FABP4는 지방세포(adipocytes), 대식세포(macrophages), 단핵세포 유래 수지상세포(monocyte-derived dendritic cells), 근상피세포(myoepithelial cells)에서 발현됩니다. 이 단백질은 긴 사슬 지방산과 레티노산(retinoic acid)을 핵 내 수용체로 전달합니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific FABP5 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific FABP2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific FABP4 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific FABP2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Factor VIII Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|