
Thermo Fisher Scientific SMAD1/SMAD5 Polyclonal Antibody
SMAD1/SMAD5 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal 항체. Western blot에 적합하며, 인간, 마우스, 랫트 시료에 반응. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공. 연구용으로만 사용 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
- View 3 publications
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Published Species | Human, Mammal, Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human SMAD1/SMAD5 (KRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2747151 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The Smad family of proteins function in the transmission of extracellular signals in the TGF-beta signaling pathway. Binding of TGF-beta superfamily ligands to extracellular receptors triggers phosphorylation of Smad2 at a Serine-Serine-Methionine-Serine (SSMS) motif at its C-terminus. Phosphorylated Smad2 forms a complex with Smad4, which accumulates in the nucleus to regulate gene expression.
In mammals, eight Smad proteins have been identified, divided into three groups:
- Receptor-activated Smads (R-Smads): Smad1, Smad2, Smad3, Smad5, Smad8
- Common mediator Smads (Co-Smads): Smad4
- Inhibitory Smads (I-Smads): Smad6, Smad7
Smad1, Smad5, and Smad8 are phosphorylated in response to BMP signaling, while Smad2 and Smad3 respond to TGF-beta and activin. Phosphorylation enables R-Smad binding to Smad4, facilitating nuclear translocation and regulation of TGF-beta target genes. I-Smads inhibit this process by blocking receptor or Smad4 interactions.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific SMAD1/SMAD2/SMAD3/SMAD5 Polyclonal Antibody
599,200원

Thermo Fisher Scientific
Thermo Fisher Scientific SMAD4 Polyclonal Antibody
514,100원

Thermo Fisher Scientific
Thermo Fisher Scientific SMAD1/SMAD5 Polyclonal Antibody
555,300원

Thermo Fisher Scientific
Thermo Fisher Scientific SLPI Polyclonal Antibody
514,100원

Thermo Fisher Scientific
Thermo Fisher Scientific Nhe-1 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|