
Thermo Fisher Scientific SMAD1/SMAD5 Polyclonal Antibody
SMAD1/SMAD5 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal 항체. Western blot에 적합하며, 인간, 마우스, 랫트 시료에 반응. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공. 연구용으로만 사용 가능.
- 카탈로그번호
- PA580036
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific SMAD1/SMAD5 Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
- View 3 publications
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Published Species | Human, Mammal, Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human SMAD1/SMAD5 (KRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2747151 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The Smad family of proteins function in the transmission of extracellular signals in the TGF-beta signaling pathway. Binding of TGF-beta superfamily ligands to extracellular receptors triggers phosphorylation of Smad2 at a Serine-Serine-Methionine-Serine (SSMS) motif at its C-terminus. Phosphorylated Smad2 forms a complex with Smad4, which accumulates in the nucleus to regulate gene expression.
In mammals, eight Smad proteins have been identified, divided into three groups:
- Receptor-activated Smads (R-Smads): Smad1, Smad2, Smad3, Smad5, Smad8
- Common mediator Smads (Co-Smads): Smad4
- Inhibitory Smads (I-Smads): Smad6, Smad7
Smad1, Smad5, and Smad8 are phosphorylated in response to BMP signaling, while Smad2 and Smad3 respond to TGF-beta and activin. Phosphorylation enables R-Smad binding to Smad4, facilitating nuclear translocation and regulation of TGF-beta target genes. I-Smads inhibit this process by blocking receptor or Smad4 interactions.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
