CacheBy
Thermo Fisher Scientific SMAD1/SMAD5 Polyclonal Antibody
원본

Thermo Fisher Scientific SMAD1/SMAD5 Polyclonal Antibody

상품 한눈에 보기

SMAD1/SMAD5 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal 항체. Western blot에 적합하며, 인간, 마우스, 랫트 시료에 반응. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공. 연구용으로만 사용 가능.

카탈로그번호
PA580036
판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 01. 오전 08:46
Thermo Fisher Scientific PA580036 SMAD1/SMAD5 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
555,300원VAT 포함 610,830원

Thermo Fisher Scientific · Thermo Fisher Scientific SMAD1/SMAD5 Polyclonal Antibody

Applications

Western Blot (WB)


Product Specifications

항목 내용
Species Reactivity Human, Mouse, Rat
Published Species Human, Mammal, Mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence of human SMAD1/SMAD5 (KRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEK)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS with 4 mg trehalose
Contains 0.05 mg sodium azide
Storage Conditions -20°C
Shipping Conditions Wet ice
RRID AB_2747151

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.


Target Information

The Smad family of proteins function in the transmission of extracellular signals in the TGF-beta signaling pathway. Binding of TGF-beta superfamily ligands to extracellular receptors triggers phosphorylation of Smad2 at a Serine-Serine-Methionine-Serine (SSMS) motif at its C-terminus. Phosphorylated Smad2 forms a complex with Smad4, which accumulates in the nucleus to regulate gene expression.

In mammals, eight Smad proteins have been identified, divided into three groups:

  • Receptor-activated Smads (R-Smads): Smad1, Smad2, Smad3, Smad5, Smad8
  • Common mediator Smads (Co-Smads): Smad4
  • Inhibitory Smads (I-Smads): Smad6, Smad7

Smad1, Smad5, and Smad8 are phosphorylated in response to BMP signaling, while Smad2 and Smad3 respond to TGF-beta and activin. Phosphorylation enables R-Smad binding to Smad4, facilitating nuclear translocation and regulation of TGF-beta target genes. I-Smads inhibit this process by blocking receptor or Smad4 interactions.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.