Thermo Fisher Scientific MMP12 Polyclonal Antibody
Thermo Fisher Scientific의 MMP12 폴리클로날 항체는 마우스 MMP12 단백질을 인식하도록 제작된 Rabbit IgG 항체로, Western blot 및 ELISA에 적합합니다. 동결건조 형태로 제공되며 재구성 시 500 µg/mL 농도를 제공합니다. 연구용으로만 사용 가능합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific MMP12 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| ELISA | 0.1–0.5 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of mouse MMP12 (432–466aa KIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | -20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746794 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes including arthritis and metastasis. Most MMPs are secreted as inactive proproteins and activated by extracellular proteinases. The MMP12 enzyme degrades soluble and insoluble elastin and may play a role in aneurysm formation and emphysema development. The gene is part of a cluster of MMP genes localized to chromosome 11q22.3.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.