Thermo Fisher Scientific MMP12 Polyclonal Antibody
Thermo Fisher Scientific의 MMP12 폴리클로날 항체는 마우스 MMP12 단백질을 인식하도록 제작된 Rabbit IgG 항체로, Western blot 및 ELISA에 적합합니다. 동결건조 형태로 제공되며 재구성 시 500 µg/mL 농도를 제공합니다. 연구용으로만 사용 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| ELISA | 0.1–0.5 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of mouse MMP12 (432–466aa KIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | -20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746794 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes including arthritis and metastasis. Most MMPs are secreted as inactive proproteins and activated by extracellular proteinases. The MMP12 enzyme degrades soluble and insoluble elastin and may play a role in aneurysm formation and emphysema development. The gene is part of a cluster of MMP genes localized to chromosome 11q22.3.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific MMP24 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific MLH1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific MMP12 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific MMP10 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific MICB Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|