
원본
Thermo Fisher Scientific MLH1 Polyclonal Antibody
상품 한눈에 보기
Thermo Fisher Scientific의 MLH1 Polyclonal Antibody는 인간 MLH1 단백질을 표적으로 하는 토끼 다클론 항체입니다. Western blot 및 ChIP assay에 사용 가능하며, 항원 친화 크로마토그래피로 정제되었습니다. DNA 불일치 복구 연구 및 암 관련 연구용으로 적합합니다.
- 카탈로그번호
- PA579675
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 01. 오후 08:09
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA579675 MLH1 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific MLH1 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| ChIP assay (ChIP) | 2.5 µg/10⁶ cells |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to the C-terminus of human MLH1 (722–756 aa: KALRSHILPPKHFTEDGNILQLANLPDLYKVFERC) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | -20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746790 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
MLH1은 DNA 불일치 복구 단백질로, 유전 정보의 안정성을 유지하는 데 필수적입니다. 복제 중 염기서열 불일치로 인한 미소위성 불안정성(MSI)은 DNA 복구 경로 결함과 관련되어 있으며, 이는 인간 발암 과정과 연관됩니다. MLH1 유전자는 유전성 비용종성 대장암(HNPC)의 원인 유전자로 확인되었습니다. MSH2는 복제 중 불일치 염기를 인식하며, MLH1과 PMSH의 이합체가 결합하여 복구 과정을 촉진합니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
