CacheBy
Thermo Fisher Scientific MLH1 Polyclonal Antibody
원본

Thermo Fisher Scientific MLH1 Polyclonal Antibody

상품 한눈에 보기

Thermo Fisher Scientific의 MLH1 Polyclonal Antibody는 인간 MLH1 단백질을 표적으로 하는 토끼 다클론 항체입니다. Western blot 및 ChIP assay에 사용 가능하며, 항원 친화 크로마토그래피로 정제되었습니다. DNA 불일치 복구 연구 및 암 관련 연구용으로 적합합니다.

카탈로그번호
PA579675
판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 01. 오후 08:09
Thermo Fisher Scientific PA579675 MLH1 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific MLH1 Polyclonal Antibody

Applications and Tested Dilution

Application Tested Dilution
Western Blot (WB) 0.1–0.5 µg/mL
ChIP assay (ChIP) 2.5 µg/10⁶ cells

Product Specifications

항목 내용
Species Reactivity Human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen Synthetic peptide corresponding to the C-terminus of human MLH1 (722–756 aa: KALRSHILPPKHFTEDGNILQLANLPDLYKVFERC)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage buffer PBS with 5 mg BSA
Contains 0.05 mg sodium azide
Storage conditions -20°C
Shipping conditions Ambient (domestic); Wet ice (international)
RRID AB_2746790

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

MLH1은 DNA 불일치 복구 단백질로, 유전 정보의 안정성을 유지하는 데 필수적입니다. 복제 중 염기서열 불일치로 인한 미소위성 불안정성(MSI)은 DNA 복구 경로 결함과 관련되어 있으며, 이는 인간 발암 과정과 연관됩니다. MLH1 유전자는 유전성 비용종성 대장암(HNPC)의 원인 유전자로 확인되었습니다. MSH2는 복제 중 불일치 염기를 인식하며, MLH1과 PMSH의 이합체가 결합하여 복구 과정을 촉진합니다.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.