Thermo Fisher Scientific MLH1 Polyclonal Antibody
Thermo Fisher Scientific의 MLH1 Polyclonal Antibody는 인간 MLH1 단백질을 표적으로 하는 토끼 다클론 항체입니다. Western blot 및 ChIP assay에 사용 가능하며, 항원 친화 크로마토그래피로 정제되었습니다. DNA 불일치 복구 연구 및 암 관련 연구용으로 적합합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| ChIP assay (ChIP) | 2.5 µg/10⁶ cells |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to the C-terminus of human MLH1 (722–756 aa: KALRSHILPPKHFTEDGNILQLANLPDLYKVFERC) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | -20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746790 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
MLH1은 DNA 불일치 복구 단백질로, 유전 정보의 안정성을 유지하는 데 필수적입니다. 복제 중 염기서열 불일치로 인한 미소위성 불안정성(MSI)은 DNA 복구 경로 결함과 관련되어 있으며, 이는 인간 발암 과정과 연관됩니다. MLH1 유전자는 유전성 비용종성 대장암(HNPC)의 원인 유전자로 확인되었습니다. MSH2는 복제 중 불일치 염기를 인식하며, MLH1과 PMSH의 이합체가 결합하여 복구 과정을 촉진합니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific MMP16 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific MMP24 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific MLH1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific MMP12 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific MMP10 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|