Thermo Fisher Scientific HAS1 Polyclonal Antibody
Rabbit polyclonal antibody targeting human HAS1 protein. Validated for WB, IHC(P), and ICC/IF. Affinity purified and lyophilized form for high specificity. Suitable for research on hyaluronic acid synthesis and related cellular processes.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific HAS1 Polyclonal Antibody
Applications and Tested Dilutions
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL | View 1 publication |
| Immunohistochemistry (Paraffin) (IHC-P) | 0.5–1 µg/mL | - |
| Immunocytochemistry (ICC/IF) | 2 µg/mL | - |
Product Specifications
| Specification | Details |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Published Species | Not Applicable |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human HAS1 (NRAEDLYMVDMFREVFADEDPATYVWDGNYHQPWEPA) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | No preservative |
| Storage Conditions | Store at 4°C short term. For long-term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2807401 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Hyaluronic acid (HA) is a high molecular weight unbranched polysaccharide synthesized by a wide variety of organisms, from bacteria to mammals. It is a major component of the extracellular matrix, consisting of alternating glucuronic acid and N-acetylglucosamine residues linked by β-1,3 and β-1,4 glycosidic bonds. HA is synthesized by membrane-bound synthase at the inner surface of the plasma membrane and extruded into the extracellular space.
HA functions include:
- Space filling and joint lubrication
- Providing a matrix for cell migration
- Supporting wound healing and tissue repair
- Facilitating blood vessel and fibroblast ingrowth
Changes in HA concentration are associated with inflammatory and degenerative arthropathies such as rheumatoid arthritis. The interaction of HA with the leukocyte receptor CD44 is important for tissue-specific homing of leukocytes, and overexpression of HA receptors correlates with tumor metastasis.
HAS1 is part of the vertebrate gene family encoding hyaluronan synthases and shows significant homology to the hasA gene product of Streptococcus pyogenes.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.