Thermo Fisher Scientific SI Polyclonal Antibody
Thermo Fisher Scientific의 SI Polyclonal Antibody는 인간, 마우스, 랫트 시료에 반응하는 Rabbit IgG 폴리클로날 항체입니다. Western blot 및 IHC(P) 적용 가능하며, 고순도 친화 크로마토그래피로 정제되었습니다. 장기 보관 시 -20°C에서 안정적으로 유지됩니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific SI Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P))
- Tested Dilution: 0.5–1 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human SI (FQLSRWNYKSLDVVKEVVRRNREAGIPFDTQVTDID) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2807411 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
This gene encodes a sucrase-isomaltase enzyme expressed in the intestinal brush border. The precursor protein is cleaved by pancreatic proteases into two enzymatic subunits, sucrase and isomaltase, which heterodimerize to form the sucrose-isomaltase complex. This complex is essential for digestion of dietary carbohydrates such as starch, sucrose, and isomaltose. Mutations in this gene cause congenital sucrase-isomaltase deficiency.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.