CacheBy
Thermo Fisher Scientific SI Polyclonal Antibody
원본

Thermo Fisher Scientific SI Polyclonal Antibody

상품 한눈에 보기

Thermo Fisher Scientific의 SI Polyclonal Antibody는 인간, 마우스, 랫트 시료에 반응하는 Rabbit IgG 폴리클로날 항체입니다. Western blot 및 IHC(P) 적용 가능하며, 고순도 친화 크로마토그래피로 정제되었습니다. 장기 보관 시 -20°C에서 안정적으로 유지됩니다.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오전 05:18
Thermo Fisher Scientific PA595609 SI Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
618,800원VAT 포함 680,680원

Thermo Fisher Scientific · Thermo Fisher Scientific SI Polyclonal Antibody

Applications

Western Blot (WB)

  • Tested Dilution: 0.1–0.5 µg/mL

Immunohistochemistry (Paraffin) (IHC (P))

  • Tested Dilution: 0.5–1 µg/mL

Product Specifications

항목 내용
Species Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence of human SI (FQLSRWNYKSLDVVKEVVRRNREAGIPFDTQVTDID)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Affinity chromatography
Storage Buffer PBS with 4 mg trehalose
Contains 0.05 mg sodium azide
Storage Conditions Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Shipping Conditions Wet ice
RRID AB_2807411

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.


Target Information

This gene encodes a sucrase-isomaltase enzyme expressed in the intestinal brush border. The precursor protein is cleaved by pancreatic proteases into two enzymatic subunits, sucrase and isomaltase, which heterodimerize to form the sucrose-isomaltase complex. This complex is essential for digestion of dietary carbohydrates such as starch, sucrose, and isomaltose. Mutations in this gene cause congenital sucrase-isomaltase deficiency.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.