Thermo Fisher Scientific SI Polyclonal Antibody
Thermo Fisher Scientific의 SI Polyclonal Antibody는 인간, 마우스, 랫트 시료에 반응하는 Rabbit IgG 폴리클로날 항체입니다. Western blot 및 IHC(P) 적용 가능하며, 고순도 친화 크로마토그래피로 정제되었습니다. 장기 보관 시 -20°C에서 안정적으로 유지됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P))
- Tested Dilution: 0.5–1 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human SI (FQLSRWNYKSLDVVKEVVRRNREAGIPFDTQVTDID) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2807411 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
This gene encodes a sucrase-isomaltase enzyme expressed in the intestinal brush border. The precursor protein is cleaved by pancreatic proteases into two enzymatic subunits, sucrase and isomaltase, which heterodimerize to form the sucrose-isomaltase complex. This complex is essential for digestion of dietary carbohydrates such as starch, sucrose, and isomaltose. Mutations in this gene cause congenital sucrase-isomaltase deficiency.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific MKNK2A Polyclonal Antibody
689,200원
Thermo Fisher Scientific
Thermo Fisher Scientific C2orf33 Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific SI Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific HAS1 Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific IFN gamma Polyclonal Antibody
618,800원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|