Merck Anti-CDK17 antibody produced in rabbit
다른 상품 둘러보기
Anti-CDK17 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-Serine/threonine-protein kinase PCTAIRE-2, Anti-PCTAIRE- motif protein kinase 2, Anti-PCTK2 antibody produced in rabbit
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500
면역원 서열
RRLSLTLRGSQTIDESLSELAEQMTIEENSSKDNEPIVKNGRPPTSHSMHSFLHQYTGSFKKPPLRRPHSVIGGSLGSFMAMPRNGSRLDIVHENLKMGSDGESDQASGTSSDEVQSPTGVCLRNRI
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... PCTK2(5128)
CDK17 (cyclin-dependent kinase 17) belongs to a subfamily of Cdc2-related kinases, and is exclusively expressed in brain. It is expressed usually in post-mitotic cells. In brains, it has predominant expression in olfactory bulb and hippocampus, which are generally made of post-mitotic neurons. This gene is localized to human chromosome 12q23.1, which codes for a protein composed of 523 amino acids, and has a molecular weight of 60kDa. It contains a central kinase domain and one N- and C-terminal domain each.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|