
Merck Anti-SFXN1 antibody produced in rabbit
Rabbit 유래의 Anti-SFXN1 항체로, human, rat, mouse 시료에 반응. Western blot, IF, IHC에 적합하며, Prestige Antibodies® 라인 제품. SFXN1 단백질(철 대사 관련 미토콘드리아 단백질) 연구에 유용.
- 카탈로그번호
- HPA019543-100UL
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Merck Sigma · Merck Anti-SFXN1 antibody produced in rabbit
Anti-SFXN1 antibody produced in rabbit
제품 설명
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
Synonyms:
Anti-Tricarboxylate carrier protein, Anti-Sideroflexin-1, Anti-TCC
SFXN1 (sideroflexin 1), also known as TCC (tricarboxylate carrier), is a mitochondrial transmembrane protein belonging to the sideroflexin family. It is mainly associated with iron metabolism and functions as part of the shuttle system that transports mitochondrial acetyl-CoA into the cytosol for lipogenesis (fatty acid synthesis).
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 유형 | Primary antibody |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태 | Buffered aqueous glycerol solution |
| Species Reactivity | Human, Rat, Mouse |
| 포장 | 25 μL (Small pack) |
| Technique(s) | Immunoblotting: 0.04–0.4 μg/mL Immunofluorescence: 0.25–2 μg/mL Immunohistochemistry: 1:50–1:200 |
| 면역원 서열 | SGELPPNINIKEPRWDQSTFIGRANHFFTVTDPRNILLTNEQLESARKIVHDYRQGIVPPGLTENELWRAKYIYDSAFHPDTGEKMILIGRMSAQV |
| UniProt 수납 번호 | Q9H9B4 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20 °C |
| Gene Information | Human: SFXN1 (94081) |
관련 정보
SFXN1은 철 대사에 관여하는 미토콘드리아 막단백질로, 세포 내 지방산 합성 과정과 관련된 아세틸-CoA 수송 시스템의 주요 구성 요소입니다.
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



