CacheBy
Merck Anti-SFXN1 antibody produced in rabbit
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Merck Anti-SFXN1 antibody produced in rabbit

상품 한눈에 보기

Rabbit 유래의 Anti-SFXN1 항체로, human, rat, mouse 시료에 반응. Western blot, IF, IHC에 적합하며, Prestige Antibodies® 라인 제품. SFXN1 단백질(철 대사 관련 미토콘드리아 단백질) 연구에 유용.

카탈로그번호
HPA019543-100UL
브랜드
Merck Sigma
판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2026. 01. 28. 오후 05:41
Merck HPA019543-100UL Anti-SFXN1 antibody produced in rabbit, 100uL pk판매 단위 pk ·
재고 확인 필요
840,700원VAT 포함 924,770원

Merck Sigma · Merck Anti-SFXN1 antibody produced in rabbit

Anti-SFXN1 antibody produced in rabbit

제품 설명

Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution

Synonyms:
Anti-Tricarboxylate carrier protein, Anti-Sideroflexin-1, Anti-TCC

SFXN1 (sideroflexin 1), also known as TCC (tricarboxylate carrier), is a mitochondrial transmembrane protein belonging to the sideroflexin family. It is mainly associated with iron metabolism and functions as part of the shuttle system that transports mitochondrial acetyl-CoA into the cytosol for lipogenesis (fatty acid synthesis).

제품 정보

항목 내용
생물학적 소스 Rabbit
Quality Level 100
결합 Unconjugated
항체 형태 Affinity isolated antibody
항체 유형 Primary antibody
클론 Polyclonal
제품 라인 Prestige Antibodies® Powered by Atlas Antibodies
형태 Buffered aqueous glycerol solution
Species Reactivity Human, Rat, Mouse
포장 25 μL (Small pack)
Technique(s) Immunoblotting: 0.04–0.4 μg/mL
Immunofluorescence: 0.25–2 μg/mL
Immunohistochemistry: 1:50–1:200
면역원 서열 SGELPPNINIKEPRWDQSTFIGRANHFFTVTDPRNILLTNEQLESARKIVHDYRQGIVPPGLTENELWRAKYIYDSAFHPDTGEKMILIGRMSAQV
UniProt 수납 번호 Q9H9B4
배송 상태 Wet ice
저장 온도 −20 °C
Gene Information Human: SFXN1 (94081)

관련 정보

SFXN1은 철 대사에 관여하는 미토콘드리아 막단백질로, 세포 내 지방산 합성 과정과 관련된 아세틸-CoA 수송 시스템의 주요 구성 요소입니다.

Merck Sigma 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.