상품 옵션 정보 | ||||||||
---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA011126-100UL | - | Merck HPA011126-100UL Anti-BTN1A1 antibody produced in rabbit, 100uL pk | 재고문의 | pk | 951,160원 | - | 1,046,276원 |
Anti-BTN1A1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-Butyrophilin subfamily 1 member A1 precursor, Anti-BT
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
면역원 서열
DYESGDISFYNMNDGSDIYTFSNVTFSGPLRPFFCLWSSGKKPLTICPIADGPERVTVIANAQDLSKEIPLSPMGEDSAPRDADTLHSKLIPTQPSQGA
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... BTN1A1(696)
BTN1A1 (butyrophilin, subfamily 1, member A1) belongs to the BTN gene family, which resides within the major histocompatibility complex class I region on gene 6p22.1. This protein is composed of 526 amino acids and has a hydrophobic signal sequence at its N-terminal, which is made of 26 amino acids. The signal peptide is cleaved off before the secretion of the protein. BTN1A1 also belongs to immunoglobulin (Ig) superfamily, where the Ig domains are present in the extracellular region. The protein has a transmembrane region and short heptad repeats in the cytoplasmic tail. It is predominantly expressed in the epithelium of lactating mammary gland.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|