Merck Anti-KIAA1217 antibody produced in rabbit
다른 상품 둘러보기
Anti-KIAA1217 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-Sickle tail protein homolog
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50
면역원 서열
KEEPHKLDSLLKRVRSMTDVLTMLRRHVTDGLLKGTDAAQAAQYMAMEKATAAEVLKSQEEAAHTSGQPFHSTGAPGDAKSEVVPLSGMMVRHAQSSPVVIQPSQ
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... KIAA1217(56243)
KIAA1217, also called SKT, is a human gene, which is homologous in nature to murine Sickle tail (Skt) gene. In mouse, the Skt gene is located in the proximal region of chromosome 2. However, in humans, the gene KIAA1217 is still designated as a hypothetical locus. SKT gene is expressed in intervertebral discs in the nucleus pulposa, in both humans and mice.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|