Merck Anti-POLH antibody produced in rabbit
다른 상품 둘러보기
Anti-POLH antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-polymerase (DNA directed), eta, Anti-RAD30A, Anti-XP-V
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500
면역원 서열
ERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTAEETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTLVSHGSVPQLFSQMPIRKIRSL
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... POLH(5429)
DNA polymerase η is a member of Y family of specialized DNA polymerases, encoded by skin cancer susceptibly gene POLH or XPV (xeroderma pigmentosum variant), mapped to human chromosome band 6p21.1-6p12. The gene with 11 exons, spanning whole coding sequence, does not contain TATA sequence in the upstream region of the transcription-initiation. DNA polymerase η is a human homologue of the yeast Rad30 protein and it belongs to the damage-bypass replication protein family.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|