Merck Anti-MEGF9 antibody produced in rabbit
다른 상품 둘러보기
Anti-MEGF9 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-Multiple epidermal growth factor-like domains 9 precursor, Anti-Multiple EGF-like domain protein 5, Anti-EGF-like domain-containing protein 5
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:20- 1:50
면역원 서열
YQNRKLNAPFWTIELKEDNISFSSYHDSIPNADVSGLLEDDGNEVAPNGQLTLT
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... MEGF9(1955)
The gene MEGF9 (multiple epidermal growth factor-like domains 9) encodes a transmembrane protein containing multiple EGF-like repeats. The N-terminus contains several potential O-glycosylation sites followed by five EGF-like domains. It also contains a single pass transmembrane domain followed by a highly conserved short intracellular domain that has potential phosphorylation sites. The mRNA is found to be expressed in the developing and adult CNS (central nervous system) and PNS (peripheral nervous system), particularly in Purkinje cells of the cerebellum and in glial cells of the PNS. It is also found to some extent in the epidermal layer of skin, papillae of the tongue and the epithelium of the gastrointestinal tract. The gene is mapped to human chromosome 9q32–9q33.3. The human gene consists of six exons spanning a length of 113.66kb. The signal peptide sequence and an N-terminal domain are encoded by exon 1, exons 2–5 encode EGF-like repeats 1–5, and exon 6 encodes a transmembrane region and a cytoplasmic tail. A long untranslated region of 4326bp is also encoded by exon 6. The 3′ end contains a conserved polyadenylation site.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|