Merck Anti-MEGF9 antibody produced in rabbit

Anti-MEGF9 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Anti-Multiple epidermal growth factor-like domains 9 precursor, Anti-Multiple EGF-like domain protein 5, Anti-EGF-like domain-containing protein 5

생물학적 소스

rabbit

Quality Level

100

결합

unconjugated

항체 형태

affinity isolated antibody

antibody product type

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

포장

antibody small pack of 25 μL

technique(s)

immunohistochemistry: 1:20- 1:50

면역원 서열

YQNRKLNAPFWTIELKEDNISFSSYHDSIPNADVSGLLEDDGNEVAPNGQLTLT

UniProt 수납 번호

Q9H1U4

배송 상태

wet ice

저장 온도

−20°C

Gene Information

human ... MEGF9(1955)

The gene MEGF9 (multiple epidermal growth factor-like domains 9) encodes a transmembrane protein containing multiple EGF-like repeats. The N-terminus contains several potential O-glycosylation sites followed by five EGF-like domains. It also contains a single pass transmembrane domain followed by a highly conserved short intracellular domain that has potential phosphorylation sites. The mRNA is found to be expressed in the developing and adult CNS (central nervous system) and PNS (peripheral nervous system), particularly in Purkinje cells of the cerebellum and in glial cells of the PNS. It is also found to some extent in the epidermal layer of skin, papillae of the tongue and the epithelium of the gastrointestinal tract. The gene is mapped to human chromosome 9q32–9q33.3. The human gene consists of six exons spanning a length of 113.66kb. The signal peptide sequence and an N-terminal domain are encoded by exon 1, exons 2–5 encode EGF-like repeats 1–5, and exon 6 encodes a transmembrane region and a cytoplasmic tail. A long untranslated region of 4326bp is also encoded by exon 6. The 3′ end contains a conserved polyadenylation site.