
Merck Anti-MEGF9 antibody produced in rabbit
Rabbit에서 생산된 Anti-MEGF9 폴리클로날 항체로, 인간 MEGF9 단백질을 특이적으로 인식합니다. Prestige Antibodies® 라인 제품으로 면역조직화학(IHC)에 적합하며, −20°C에서 보관합니다. 버퍼드 글리세롤 용액 형태로 제공됩니다.
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Merck Sigma · Merck Anti-MEGF9 antibody produced in rabbit
Anti-MEGF9 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
Synonyms
- Anti-Multiple epidermal growth factor-like domains 9 precursor
- Anti-Multiple EGF-like domain protein 5
- Anti-EGF-like domain-containing protein 5
제품 사양
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 유형 | Primary antibody |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태 | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| 포장 | 25 μL (small pack) |
| 사용 기술 | Immunohistochemistry (IHC): 1:20–1:50 |
| 면역원 서열 | YQNRKLNAPFWTIELKEDNISFSSYHDSIPNADVSGLLEDDGNEVAPNGQLTLT |
| UniProt 번호 | Q9H1U4 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
Gene Information
Human MEGF9 (1955)
The gene MEGF9 (multiple epidermal growth factor-like domains 9) encodes a transmembrane protein containing multiple EGF-like repeats. The N-terminus contains several potential O-glycosylation sites followed by five EGF-like domains. It also contains a single-pass transmembrane domain followed by a highly conserved short intracellular domain with potential phosphorylation sites.
The mRNA is expressed in both developing and adult CNS (central nervous system) and PNS (peripheral nervous system), particularly in Purkinje cells of the cerebellum and glial cells of the PNS. Expression is also observed to some extent in the epidermal layer of skin, papillae of the tongue, and the epithelium of the gastrointestinal tract.
The gene is mapped to human chromosome 9q32–9q33.3 and consists of six exons spanning 113.66 kb.
- Exon 1: Signal peptide sequence and N-terminal domain
- Exons 2–5: Encode EGF-like repeats 1–5
- Exon 6: Encodes transmembrane region and cytoplasmic tail
- Exon 6 also includes a long untranslated region (4326 bp) and a conserved polyadenylation site.
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



