
Merck Anti-MEGF9 antibody produced in rabbit
Rabbit에서 생산된 Anti-MEGF9 폴리클로날 항체로, 인간 MEGF9 단백질을 특이적으로 인식합니다. Prestige Antibodies® 라인 제품으로 면역조직화학(IHC)에 적합하며, −20°C에서 보관합니다. 버퍼드 글리세롤 용액 형태로 제공됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MEGF9 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
Synonyms
- Anti-Multiple epidermal growth factor-like domains 9 precursor
- Anti-Multiple EGF-like domain protein 5
- Anti-EGF-like domain-containing protein 5
제품 사양
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 유형 | Primary antibody |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태 | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| 포장 | 25 μL (small pack) |
| 사용 기술 | Immunohistochemistry (IHC): 1:20–1:50 |
| 면역원 서열 | YQNRKLNAPFWTIELKEDNISFSSYHDSIPNADVSGLLEDDGNEVAPNGQLTLT |
| UniProt 번호 | Q9H1U4 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
Gene Information
Human MEGF9 (1955)
The gene MEGF9 (multiple epidermal growth factor-like domains 9) encodes a transmembrane protein containing multiple EGF-like repeats. The N-terminus contains several potential O-glycosylation sites followed by five EGF-like domains. It also contains a single-pass transmembrane domain followed by a highly conserved short intracellular domain with potential phosphorylation sites.
The mRNA is expressed in both developing and adult CNS (central nervous system) and PNS (peripheral nervous system), particularly in Purkinje cells of the cerebellum and glial cells of the PNS. Expression is also observed to some extent in the epidermal layer of skin, papillae of the tongue, and the epithelium of the gastrointestinal tract.
The gene is mapped to human chromosome 9q32–9q33.3 and consists of six exons spanning 113.66 kb.
- Exon 1: Signal peptide sequence and N-terminal domain
- Exons 2–5: Encode EGF-like repeats 1–5
- Exon 6: Encodes transmembrane region and cytoplasmic tail
- Exon 6 also includes a long untranslated region (4326 bp) and a conserved polyadenylation site.
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Merck Sigma
Merck Anti-TDG antibody produced in rabbit
817,800원

Merck Sigma
Merck Anti-Cas9
593,400원

Merck Sigma
Merck Anti-MEGF9 antibody produced in rabbit
895,700원

Merck Sigma
Merck Anti-RNF187 antibody produced in rabbit
817,800원

Merck Sigma
Merck Anti-Fibroblast Surface Protein antibody, Mouse monoclonal
642,600원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|