CacheBy
Merck Anti-MEGF9 antibody produced in rabbit
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Merck Anti-MEGF9 antibody produced in rabbit

상품 한눈에 보기

Rabbit에서 생산된 Anti-MEGF9 폴리클로날 항체로, 인간 MEGF9 단백질을 특이적으로 인식합니다. Prestige Antibodies® 라인 제품으로 면역조직화학(IHC)에 적합하며, −20°C에서 보관합니다. 버퍼드 글리세롤 용액 형태로 제공됩니다.

브랜드
Merck Sigma
판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Merck HPA014319-100UL Anti-MEGF9 antibody produced in rabbit, 100uL pk판매 단위 pk
재고 확인 필요
920,800원VAT 포함 1,012,880원

Merck Sigma · Merck Anti-MEGF9 antibody produced in rabbit

Anti-MEGF9 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies

Affinity isolated antibody, buffered aqueous glycerol solution

Synonyms

  • Anti-Multiple epidermal growth factor-like domains 9 precursor
  • Anti-Multiple EGF-like domain protein 5
  • Anti-EGF-like domain-containing protein 5

제품 사양

항목 내용
생물학적 소스 Rabbit
Quality Level 100
결합 Unconjugated
항체 형태 Affinity isolated antibody
항체 유형 Primary antibody
클론 Polyclonal
제품 라인 Prestige Antibodies® Powered by Atlas Antibodies
형태 Buffered aqueous glycerol solution
Species Reactivity Human
포장 25 μL (small pack)
사용 기술 Immunohistochemistry (IHC): 1:20–1:50
면역원 서열 YQNRKLNAPFWTIELKEDNISFSSYHDSIPNADVSGLLEDDGNEVAPNGQLTLT
UniProt 번호 Q9H1U4
배송 상태 Wet ice
저장 온도 −20°C

Gene Information

Human MEGF9 (1955)
The gene MEGF9 (multiple epidermal growth factor-like domains 9) encodes a transmembrane protein containing multiple EGF-like repeats. The N-terminus contains several potential O-glycosylation sites followed by five EGF-like domains. It also contains a single-pass transmembrane domain followed by a highly conserved short intracellular domain with potential phosphorylation sites.

The mRNA is expressed in both developing and adult CNS (central nervous system) and PNS (peripheral nervous system), particularly in Purkinje cells of the cerebellum and glial cells of the PNS. Expression is also observed to some extent in the epidermal layer of skin, papillae of the tongue, and the epithelium of the gastrointestinal tract.

The gene is mapped to human chromosome 9q32–9q33.3 and consists of six exons spanning 113.66 kb.

  • Exon 1: Signal peptide sequence and N-terminal domain
  • Exons 2–5: Encode EGF-like repeats 1–5
  • Exon 6: Encodes transmembrane region and cytoplasmic tail
  • Exon 6 also includes a long untranslated region (4326 bp) and a conserved polyadenylation site.

Merck Sigma 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.