상품 옵션 정보 | ||||||||
---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA010698-100UL | - | Merck HPA010698-100UL Anti-ATP1B2 antibody produced in rabbit, 100uL pk | 재고문의 | pk | 951,160원 | - | 1,046,276원 |
Anti-ATP1B2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunohistochemistry: 1:50-1:200
면역원 서열
TVSDHTPKYQDRLATPGLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDST
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... ATP1B2(482)
ATP1B2 (ATPase, Na+/K+ transporting, β 2 polypeptide) gene encodes a member of the family of Na+/K+ and H+/K+ ATPases β chain proteins, and a subfamily of Na+/K+ -ATPases. The basic Na+/K+ -ATPase contains a catalytic α subunit and an N-glycosylated β subunit that participates in maturation and membrane targeting of the enzyme. The α subunit is present in four isoforms (α1, α2, α3 and α4) and the β-subunit comprises three isoforms (β1, β2, and β3). ATP1B2, the β2 subunit gene, consists of seven exons interspaced by six introns.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|