Merck Anti-CD300C antibody produced in rabbit
Rabbit polyclonal antibody against human CD300C, part of Prestige Antibodies® Powered by Atlas Antibodies. Affinity isolated, unconjugated, suitable for immunoblotting and immunohistochemistry. Stored at −20°C, shipped on wet ice.
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Merck Sigma · Merck Anti-CD300C antibody produced in rabbit
Anti-CD300C antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution.
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 유형 | Primary antibody |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태 | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| 포장 | 25 μL (small pack) |
| 향상된 검증 | Recombinant expression |
| Technique(s) | Immunoblotting: 0.04–0.4 μg/mL Immunohistochemistry: 1:200–1:500 |
| 면역원 서열 | PWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR |
| UniProt 수납 번호 | Q08708 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
| Gene Information | Human CD300C(10871) |
Gene Description
CD300C (CD300c molecule) is a membrane receptor belonging to the IgV-like glycoprotein family called CD300. This family includes activating members (CD300b, CD300c, CD300d, CD300e) and inhibitory members (CD300a, CD300f).
CD300C is exclusively expressed by monocytes and leukocytes and was the first member of this family to be identified. Its transmembrane domain contains a negatively charged amino acid and has a short cytosolic region.
This gene is localized to human chromosome 17, spans approximately 4.5 kb, and has four exons. Exon 1 encodes the signal peptide and 5′-untranslated region, exon 2 encodes the Ig-like domain, exon 3 encodes the region proximal to the membrane, and exon 4 encodes the transmembrane region.
참고 링크
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.