상품 옵션 정보 | ||||||||
---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA014523-100UL | - | Merck HPA014523-100UL Anti-CD300C antibody produced in rabbit, 100uL pk | 재고문의 | pk | 951,160원 | - | 1,046,276원 |
Anti-CD300C antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
recombinant expression
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500
면역원 서열
PWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... CD300C(10871)
CD300C (CD300c molecule) is a membrane receptor belonging to the IgV-like glycoprotein family called CD300. This family includes activating members namely, CD300b, CD300c, CD300d and CD300e, and inhibitory members namely, CD300a and CD300f. CD300C is exclusively expressed by monocytes and leukocytes, and was the first member of this family to be identified. Its transmembrane domain contains a negatively charged amino acid, and it has a short cytosolic region. This gene is localised to human chromosome 17, spans ~4.5kb, and has four exons. The signal peptide and the 5′-untranslated region is coded by exon1, the Ig (immunoglobulin)-like domain by exon2, exon 3 encodes for the region proximal to membrane and exon 4 codes for the transmembrane region.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|