Merck Anti-CD300C antibody produced in rabbit
Rabbit polyclonal antibody against human CD300C, part of Prestige Antibodies® Powered by Atlas Antibodies. Affinity isolated, unconjugated, suitable for immunoblotting and immunohistochemistry. Stored at −20°C, shipped on wet ice.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CD300C antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution.
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 유형 | Primary antibody |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태 | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| 포장 | 25 μL (small pack) |
| 향상된 검증 | Recombinant expression |
| Technique(s) | Immunoblotting: 0.04–0.4 μg/mL Immunohistochemistry: 1:200–1:500 |
| 면역원 서열 | PWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR |
| UniProt 수납 번호 | Q08708 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
| Gene Information | Human CD300C(10871) |
Gene Description
CD300C (CD300c molecule) is a membrane receptor belonging to the IgV-like glycoprotein family called CD300. This family includes activating members (CD300b, CD300c, CD300d, CD300e) and inhibitory members (CD300a, CD300f).
CD300C is exclusively expressed by monocytes and leukocytes and was the first member of this family to be identified. Its transmembrane domain contains a negatively charged amino acid and has a short cytosolic region.
This gene is localized to human chromosome 17, spans approximately 4.5 kb, and has four exons. Exon 1 encodes the signal peptide and 5′-untranslated region, exon 2 encodes the Ig-like domain, exon 3 encodes the region proximal to the membrane, and exon 4 encodes the transmembrane region.
참고 링크
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Merck Sigma
Merck Anti-ANXA1 antibody produced in rabbit
370,530원
Merck Sigma
Merck Anti-MED21 antibody produced in rabbit
895,700원
Merck Sigma
Merck Anti-CD300C antibody produced in rabbit
895,700원
Merck Sigma
Merck Anti-C1GALT1 antibody produced in rabbit
895,700원
Merck Sigma
Merck Anti-ATP1B2 antibody produced in rabbit
895,700원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|