상품 옵션 정보 | ||||||||
---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA011337-100UL | - | Merck HPA011337-100UL Anti-CASP6 antibody produced in rabbit, 100uL pk | 재고문의 | pk | 894,810원 | - | 984,291원 |
Anti-CASP6 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
independent
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500
면역원 서열
DVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQV
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... CASP6(839)
CASP6 (caspase 6) belongs to the family of cysteine proteases called caspases. Caspases can be divided into inflammatory capases, apoptosis initiators and effector caspases, and CASP6 belongs to the effector class. It exists as a dimeric zymogen. Each CASP6 monomer contains a short pro-domain called CARD (caspase-recruitment domain) or DED (death effector domain), a large subunit (p20) and a small subunit (p10), intervened by an intersubunit linker (L). It is expressed in both fetal and adult human tissues, though it has a higher level of expression during development, and decreased levels in adult tissues. In fetus, CASP6 has the highest level of expression in the gastrointestinal tract and the lowest in brain. In adults, it is predominantly expressed in colon, lung, stomach, kidney and liver.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|