
Merck Anti-KLHL25 antibody produced in rabbit
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-KLHL25 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
recombinant expression
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500
면역원 서열
HFETVRQSEDFNSLSKDTLLDLISSDELETEDERVVFEAILQWVKHDLEPRKVHLPELLRSVRLALLPSDCLQEAVSSEALLMADERTKLIMDEALRCKTRILQNDGVVTSPCA
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... KLHL25(64410)
The gene KLHL25 (kelch like family member 25) belongs to the Kelch-like (KLHL) gene family that encodes proteins that are characterized by the presence of a BTB/POZ domain, a BACK domain, and five to six Kelch motifs. The BTB (bric à brac 1, tramtrack, and broad-complex)/POZ (poxvirus and zinc finger) domain is involved in protein binding and dimerization, and the kelch domains form tertiary structures that are important in extracellular functions, morphology, and association with other proteins. The function of the BACK (BTB and C-terminal Kelch) domain is yet to be characterized. The protein encoded by KLHL2 has five kelch domains and spans a length of 589 amino acids.
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Merck Sigma
Merck Anti-ZBTB2 antibody produced in rabbit
895,700원

Merck Sigma
Merck Anti-TTI2 antibody produced in rabbit
895,700원

Merck Sigma
Merck Anti-KLHL25 antibody produced in rabbit
895,700원

Merck Sigma
Merck Anti-ATP6V1H antibody produced in rabbit
895,700원

Merck Sigma
Merck Anti-SGSH antibody produced in rabbit
895,700원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
