CacheBy
Merck Anti-SGSH antibody produced in rabbit
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Merck Anti-SGSH antibody produced in rabbit

상품 한눈에 보기

토끼에서 생산된 Anti-SGSH 폴리클로날 항체로, 인간 SGSH 단백질을 인식합니다. Prestige Antibodies® 라인 제품이며, 면역조직화학(IHC)에 적합합니다. 정제된 항체로 buffered glycerol 용액 형태로 제공되며, −20°C에서 보관합니다.

브랜드
Merck Sigma
판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2026. 01. 28. 오후 05:41
Merck HPA023436-100UL Anti-SGSH antibody produced in rabbit, 100uL pk판매 단위 pk ·
재고 확인 필요
920,800원VAT 포함 1,012,880원

Merck Sigma · Merck Anti-SGSH antibody produced in rabbit

Anti-SGSH antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies

Affinity isolated antibody, buffered aqueous glycerol solution, Ab1


제품 정보

항목 내용
생물학적 소스 Rabbit
품질 등급 100
결합 상태 Unconjugated
항체 형태 Affinity isolated antibody
항체 유형 Primary antibodies
클론 Polyclonal
제품 라인 Prestige Antibodies® Powered by Atlas Antibodies
제형 Buffered aqueous glycerol solution
반응 종 Human
포장 Antibody small pack of 25 μL
향상된 검증 Orthogonal RNAseq, Independent
적용 기술 Immunohistochemistry: 1:200–1:500
면역원 서열 CEKFGNGESGMGRIPDWTPQAYDPLDVLVPYFVPNTPAARADLAAQYTTVGRMDQGVGLVLQELRDAGVLNDTLVIFTSDNGIPFPSGRTNLYWPGTAEPL
UniProt 번호 P51688
배송 상태 Wet ice
저장 온도 −20°C

Gene Information

Human SGSH (N-sulfoglucosamine sulfohydrolase) is a member of the sulfatase family and contains the characteristic highly conserved amino-acid sequence motif C(X)PSR.
The gene is mapped to human chromosome 17q25.3.
It consists of eight exons and seven introns, spanning approximately 11 kb.

Merck Sigma 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.